Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD40 Recombinant Protein

  • PX-P4082-100
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P25942
Molecular weight:
22.32kDa

Original price was: €500.00.Current price is: €420.00.

100ug 16% OFF + 420 loyalty points
Met1~Arg193 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD40 Recombinant Protein

Product name PX-P4082-100
Uniprot ID P25942
Uniprot link http://www.uniprot.org/uniprot/P25942
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Molecular weight 22.32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Arg193
Aliases /Synonyms TNFRSF5
Reference PX-P4082
Note For research use only
Molecular Constructor
Met1~Arg193 His
Product name PX-P4082-1MG
Uniprot ID P25942
Uniprot link http://www.uniprot.org/uniprot/P25942
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Molecular weight 22.32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Arg193
Aliases /Synonyms TNFRSF5
Reference PX-P4082
Note For research use only
Molecular Constructor
Met1~Arg193 His
Product name PX-P4082-50
Uniprot ID P25942
Uniprot link http://www.uniprot.org/uniprot/P25942
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Molecular weight 22.32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Arg193
Aliases /Synonyms TNFRSF5
Reference PX-P4082
Note For research use only
Molecular Constructor
Met1~Arg193 His

General information on CD40 Recombinant Protein:

CD40, also known as TNFRSF5, is a member of the TNF receptor superfamily, which is a single transmembrane glycoprotein. The CD40 protein plays a vital role in mediating a variety of immune and inflammatory responses, including the change in class T that depends on the type of immunoglobulin, the development of B cell memory and the formation of reproductive centers. The CD40 protein is expressed in B cells, dendritic cells, macrophages, endothelial cells and some tumor cells. CD40 deficiency can lead to high IgM type 3 (HIGM3) immunodeficiency. In addition, β-amyloid-induced microglia activation requires CD40 / CD40L interaction and is therefore considered an early event in the pathogenesis of Alzheimer’s disease.

Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb binds to CD40 Recombinant Protein in indirect ELISA Assay

Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb binds to CD40 Recombinant Protein in indirect ELISA Assay

Immobilized CD40 Recombinant Protein (cat. No.PX-P4082) at 0.5µg/mL (100µL/well) can bind to Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb (cat. No.PX-TA1503) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

CD40 Recombinant Protein

There are no reviews yet.

Be the first to review “CD40 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products