Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Teneliximab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade

  • PX-TA1196-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: €172.00.Current price is: €140.00.

50ug 19% OFF + 140 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade
SDS-PAGE for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade
Teneliximab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

Teneliximab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

Product name Teneliximab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 395639-53-9
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Teneliximab,chi220,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1196
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Teneliximab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 395639-53-9
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Teneliximab,chi220,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1196
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1196-50
Uniprot ID P25942
Source CAS 395639-53-9
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Teneliximab,chi220,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1196
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

General information on Anti-CD40/TNFRSF5(Homo sapiens) (Teneliximab) Monoclonal Antibody

Teneliximab is a chimeric monoclonal antibody that binds to the immunostimulatory protein CD40.

Flow Cytometry results for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Flow Cytometry results for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

SDS-PAGE for Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Teneliximab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Teneliximab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

There are no reviews yet.

Be the first to review “Teneliximab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products