Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Selicrelumab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade

  • PX-TA1465-50
  • Validated ELISA
Isotype:
IgG2, Kappa

Original price was: €107.00.Current price is: €84.00.

50ug 21% OFF + 84 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Selicrelumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

Product name Selicrelumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 1622140-49-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Selicrelumab,CP-870,893,RG-7876,RO-7009789,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1465
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Product name Selicrelumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 1622140-49-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Selicrelumab,CP-870,893,RG-7876,RO-7009789,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1465
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Product name PX-TA1465-50
Uniprot ID P25942
Source CAS 1622140-49-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Selicrelumab,CP-870,893,RG-7876,RO-7009789,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1465
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Product name Selicrelumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 1622140-49-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Selicrelumab,CP-870,893,RG-7876,RO-7009789,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1465
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Selicrelumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 1622140-49-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Selicrelumab,CP-870,893,RG-7876,RO-7009789,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1465
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody

Selicrelumab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade

Selicrelumab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade: A Promising Antibody for Targeting TNFRSF5

Introduction

Selicrelumab Biosimilar is a monoclonal antibody (mAb) that specifically targets CD40, also known as TNFRSF5. It belongs to the tumor necrosis factor receptor superfamily and is expressed on various immune cells, including B cells, dendritic cells, and macrophages. CD40 plays a crucial role in the regulation of immune responses and has been identified as a potential therapeutic target for various diseases. Selicrelumab Biosimilar is a research grade antibody that has shown promising results in preclinical studies and is currently being investigated for its therapeutic potential in clinical trials.

Structure of Selicrelumab Biosimilar

Selicrelumab Biosimilar is a fully humanized IgG1 monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of Selicrelumab Biosimilar specifically binds to the extracellular domain of CD40, while the constant region mediates effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Mechanism of Action

As a CD40-targeting antibody, Selicrelumab Biosimilar exerts its therapeutic effects by blocking the interaction between CD40 and its ligand, CD154. This interaction is essential for the activation and differentiation of B cells, as well as the maturation of dendritic cells. By inhibiting this interaction, Selicrelumab Biosimilar can modulate immune responses and potentially treat diseases associated with dysregulated immune function.

Applications

Selicrelumab Biosimilar has shown promising results in preclinical studies for the treatment of various diseases, including autoimmune disorders, cancer, and infectious diseases. In autoimmune disorders such as rheumatoid arthritis and systemic lupus erythematosus, Selicrelumab Biosimilar has been shown to suppress immune responses and reduce disease severity. In cancer, Selicrelumab Biosimilar has demonstrated the ability to enhance anti-tumor immune responses and inhibit tumor growth. In infectious diseases, Selicrelumab Biosimilar has been shown to improve immune responses and increase survival rates in animal models.

Clinical Trials

Selicrelumab Biosimilar is currently being investigated in several clinical trials for its therapeutic potential. In a phase 1/2 study, Selicrelumab Biosimilar is being evaluated for the treatment of systemic lupus erythematosus. In a phase 2 trial, Selicrelumab Biosimilar is being studied for the treatment of solid tumors. Additionally, Selicrelumab Biosimilar is also being evaluated in combination with other therapies in clinical trials for various diseases.

Conclusion

Selicrelumab Biosimilar is a promising monoclonal antibody that specifically targets CD40, a key regulator of immune responses. With its potential to modulate immune function and treat various diseases, Selicrelumab Biosimilar has gained attention as a potential therapeutic option. Ongoing clinical trials will provide further insights into the efficacy and safety of Selicrelumab Biosimilar, and it has the potential to become a valuable addition to the arsenal of treatments for diseases associated with dysregulated immune function.

SDS-PAGE for Selicrelumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

SDS-PAGE for Selicrelumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

Selicrelumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Selicrelumab Biosimilar - Anti-CD40; TNFRSF5 mAb - Research Grade in ELISA Assay

Selicrelumab Biosimilar - Anti-CD40; TNFRSF5 mAb - Research Grade in ELISA Assay

Selicrelumab Biosimilar - Anti-CD40; TNFRSF5 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Selicrelumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

There are no reviews yet.

Be the first to review “Selicrelumab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products