Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD40 ligand(CD40LG)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P29965
Molecular weight:
18kDa

182.00

50ug + 182 loyalty points
Glu108–Leu261 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD40 ligand(CD40LG)

Product name CD40 ligand(CD40LG)
Uniprot ID P29965
Uniprot link https://www.uniprot.org/uniprot/P29965
Expression system Prokaryotic expression
Raw Antigen Sequence MENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQ APFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKLLEHHH HHH
Molecular weight 18kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu108-Leu261
Protein Accession P29965
Spec:Entrez GeneID 959
Spec:NCBI Gene Aliases IGM; IMD3; TRAP; gp39; CD154; CD40L; HIGM1; T-BAM; TNFSF5; hCD40L
NCBI Reference P29965
Aliases /Synonyms CD40-L,T-cell antigen Gp39,TNF-related activation protein,TRAP,Tumor necrosis factor ligand superfamily member 5,CD_antigen: CD154,CD40L, TNFSF5, TRAP
Reference PX-P4855
Note For research use only
Molecular Constructor
Glu108–Leu261 His
Product name CD40 ligand(CD40LG)
Uniprot ID P29965
Uniprot link https://www.uniprot.org/uniprot/P29965
Expression system Prokaryotic expression
Raw Antigen Sequence MENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQ APFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKLLEHHH HHH
Molecular weight 18kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu108-Leu261
Protein Accession P29965
Spec:Entrez GeneID 959
Spec:NCBI Gene Aliases IGM; IMD3; TRAP; gp39; CD154; CD40L; HIGM1; T-BAM; TNFSF5; hCD40L
NCBI Reference P29965
Aliases /Synonyms CD40-L,T-cell antigen Gp39,TNF-related activation protein,TRAP,Tumor necrosis factor ligand superfamily member 5,CD_antigen: CD154,CD40L, TNFSF5, TRAP
Reference PX-P4855
Note For research use only
Molecular Constructor
Glu108–Leu261 His

Letolizumab Biosimilar - Anti-CD40LG, CD154 mAb binds to CD40 ligand(CD40LG) in indirect ELISA Assay

Letolizumab Biosimilar - Anti-CD40LG, CD154 mAb binds to CD40 ligand(CD40LG) in indirect ELISA Assay

Immobilized CD40 ligand(CD40LG) (cat. No.PX-P4855) at 0.5µg/mL (100µL/well) can bind to Letolizumab Biosimilar - Anti-CD40LG, CD154 mAb (cat. No.PX-TA1459) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

There are no reviews yet.

Be the first to review “CD40 ligand(CD40LG)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products