Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Iscalimab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade

  • PX-TA1503-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €179.00.Current price is: €140.00.

50ug 22% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

Product name Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 2031153-61-2
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Iscalimab,CFZ-533,NVP-CFZ533,OM11-62MF,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1503
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 2031153-61-2
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Iscalimab,CFZ-533,NVP-CFZ533,OM11-62MF,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1503
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1503-50
Uniprot ID P25942
Source CAS 2031153-61-2
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Iscalimab,CFZ-533,NVP-CFZ533,OM11-62MF,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1503
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Iscalimab Biosimilar, also known as Anti-CD40, TNFRSF5 mAb, is a research grade monoclonal antibody that targets the CD40 protein, a member of the tumor necrosis factor receptor superfamily. This antibody has shown promising potential as a therapeutic agent in various diseases, making it a subject of extensive research and development.

Structure of Iscalimab Biosimilar

Iscalimab Biosimilar is a fully humanized monoclonal antibody, meaning it is derived from human cells and has a high affinity and specificity for its target. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The antibody has a molecular weight of approximately 150 kDa and a half-life of 21 days.

Mechanism of Action

CD40 is a cell surface protein found on various immune cells, including B cells, dendritic cells, and macrophages. It plays a crucial role in the activation and differentiation of these immune cells, making it an attractive therapeutic target for various diseases. Iscalimab Biosimilar binds to CD40 and blocks its interaction with its ligand, CD154. This prevents the activation of downstream signaling pathways, leading to inhibition of immune cell activation and proliferation.

Applications in Disease Treatment

Iscalimab Biosimilar has shown promising results in preclinical and clinical studies as a potential treatment for various diseases. Here are some of its potential applications:

1. Autoimmune Diseases: CD40 plays a crucial role in the development of autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, and systemic lupus erythematosus. Iscalimab Biosimilar has shown promising results in preclinical studies as a potential treatment for these diseases by inhibiting the activation of autoreactive immune cells.

2.

Transplant Rejection: CD40-CD154 interaction is known to play a critical role in acute and chronic rejection of transplanted organs. Iscalimab Biosimilar has shown potential in preventing transplant rejection by blocking this interaction and reducing the activation of immune cells.

3.

Cancer: CD40 is also expressed on the surface of tumor cells and has been linked to tumor growth and survival. Iscalimab Biosimilar has shown promising results in preclinical studies as a potential treatment for various cancers, including lymphoma, leukemia, and solid tumors, by inhibiting the activation of immune cells and promoting tumor cell death.

4.

Infectious Diseases: CD40 is involved in the immune response against various infectious agents, including viruses and bacteria. Iscalimab Biosimilar has shown potential in enhancing the immune response against these pathogens by blocking CD40 and promoting the activation of immune cells.

Conclusion

Iscalimab Biosimilar is a research grade monoclonal antibody that targets the CD40 protein and has shown promising results as a potential treatment for various diseases. Its unique mechanism of action and potential applications make it a subject of extensive research and development. Further studies and clinical trials are needed to fully understand the therapeutic potential of Iscalimab Biosimilar and its role in the treatment of various diseases.

Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb binds to CD40 Recombinant Protein in indirect ELISA Assay

Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb binds to CD40 Recombinant Protein in indirect ELISA Assay

Immobilized CD40 Recombinant Protein (cat. No.PX-P4082) at 0.5µg/mL (100µL/well) can bind to Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb (cat. No.PX-TA1503) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

There are no reviews yet.

Be the first to review “Iscalimab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products