Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bleselumab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade

  • PX-TA1393-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €186.00.Current price is: €140.00.

50ug 25% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Bleselumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

Product name Bleselumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 1453067-91-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Bleselumab,4D11,ASKP-1240,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1393
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Bleselumab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 1453067-91-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Bleselumab,4D11,ASKP-1240,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1393
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1393-50
Uniprot ID P25942
Source CAS 1453067-91-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Bleselumab,4D11,ASKP-1240,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1393
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

General information on Anti-CD40/ TNFRSF5[Homo sapiens] (Bleselumab) Monoclonal Antibody

Bleselumab is investigatedfor the prevention of the Recurrence of Focal Segmental Glomerulosclerosis in case of de Novo Kidney Transplantation.

SDS-PAGE for Bleselumab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

SDS-PAGE for Bleselumab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Bleselumab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Bleselumab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade in ELISA Assay

Bleselumab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade in ELISA Assay

Bleselumab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Bleselumab Biosimilar - Anti-CD40,  TNFRSF5 mAb - Research Grade

There are no reviews yet.

Be the first to review “Bleselumab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products