Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mitazalimab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade

  • PX-TA1515-100UG
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: €256.00.Current price is: €200.00.

100ug 22% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mitazalimab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

Product name Mitazalimab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 2055640-86-1
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Mitazalimab,ADC-1013,JNJ-64457107,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1515
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Mitazalimab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 2055640-86-1
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Mitazalimab,ADC-1013,JNJ-64457107,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1515
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1515-50
Uniprot ID P25942
Source CAS 2055640-86-1
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Mitazalimab,ADC-1013,JNJ-64457107,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1515
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Introduction

Mitazalimab Biosimilar, also known as Anti-CD40, TNFRSF5 mAb, is a monoclonal antibody that specifically targets the CD40 protein, which is a member of the tumor necrosis factor receptor superfamily. This biosimilar is a research grade antibody that has shown promising results in pre-clinical studies and has the potential to be used as a therapeutic agent for various diseases.

Structure of Mitazalimab Biosimilar

Mitazalimab Biosimilar is a fully humanized monoclonal antibody, meaning it is derived from human cells and has a high affinity for its target. It is composed of two heavy chains and two light chains, which are linked together by disulfide bonds. The antibody has a molecular weight of approximately 150 kDa and a half-life of around 21 days in humans.

Mechanism of Action

CD40 is a cell surface receptor that is expressed on various immune cells, including B cells, dendritic cells, and macrophages. It plays a crucial role in the activation and differentiation of these cells, making it an attractive therapeutic target for immune-related diseases. Mitazalimab Biosimilar binds to CD40 and blocks its interaction with its ligand, CD154. This prevents the activation of downstream signaling pathways, ultimately leading to the inhibition of immune cell activation and inflammation.

Applications in Research

Mitazalimab Biosimilar has shown promising results in pre-clinical studies for the treatment of various diseases, including autoimmune disorders, cancer, and transplantation. In autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus, CD40 plays a critical role in the activation of self-reactive immune cells. By targeting CD40, Mitazalimab Biosimilar can potentially suppress the immune response and alleviate symptoms of these diseases.

In cancer, CD40 has been found to be overexpressed on tumor cells and plays a role in promoting tumor growth and survival. Mitazalimab Biosimilar has shown the potential to inhibit these effects and induce tumor cell death. Additionally, CD40 is also expressed on immune cells in the tumor microenvironment, and by blocking its activity, Mitazalimab Biosimilar can enhance the anti-tumor immune response.

In transplantation, Mitazalimab Biosimilar has the potential to prevent organ rejection by inhibiting the activation of immune cells that target the transplanted organ. This could lead to improved outcomes and reduced need for immunosuppressive drugs, which have significant side effects.

Future Directions

While Mitazalimab Biosimilar has shown promising results in pre-clinical studies, further research is needed to fully understand its potential as a therapeutic agent. Clinical trials are currently underway to evaluate its safety and efficacy in humans. If successful, Mitazalimab Biosimilar could potentially become a valuable treatment option for a wide range of diseases.

Conclusion

In summary, Mitazalimab Biosimilar is a research grade antibody that targets CD40, a key protein involved in immune cell activation and differentiation. Its unique mechanism of action makes it a promising therapeutic agent for various diseases, including autoimmune disorders, cancer, and transplantation. Further research and clinical trials will determine its potential as a treatment option, and if successful, it could significantly impact the field of immunotherapy.

Mitazalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade in ELISA Assay

Mitazalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade in ELISA Assay

Mitazalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Mitazalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

SDS-PAGE for Mitazalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Mitazalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Mitazalimab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

There are no reviews yet.

Be the first to review “Mitazalimab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products