Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cifurtilimab Biosimilar – Anti-CD40 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Cifurtilimab Biosimilar - Anti-CD40 mAb - Research Grade

Product name Cifurtilimab Biosimilar - Anti-CD40 mAb - Research Grade
Uniprot ID P25942
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Cifurtilimab,,CD40,anti-CD40
Reference PX-TA1825
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name Cifurtilimab Biosimilar - Anti-CD40 mAb - Research Grade
Uniprot ID P25942
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Cifurtilimab,,CD40,anti-CD40
Reference PX-TA1825
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1825-50
Uniprot ID P25942
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Cifurtilimab,,CD40,anti-CD40
Reference PX-TA1825
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Cifurtilimab Biosimilar

Cifurtilimab Biosimilar, also known as Anti-CD40 mAb, is a therapeutic antibody that has gained significant attention in the field of immunotherapy. This biosimilar is a monoclonal antibody that targets the CD40 protein, which is a co-stimulatory molecule found on the surface of immune cells. In this article, we will delve into the structure, activity, and potential applications of Cifurtilimab Biosimilar in the field of research.

Structure of Cifurtilimab Biosimilar

Cifurtilimab Biosimilar is a recombinant, humanized monoclonal antibody that is produced using genetic engineering techniques. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure, with two antigen-binding fragments (Fab) and one crystallizable fragment (Fc). The Fab regions are responsible for binding to the CD40 protein, while the Fc region mediates the effector functions of the antibody.

Activity of Cifurtilimab Biosimilar

The primary function of Cifurtilimab Biosimilar is to block the interaction between CD40 and its ligand, CD154. This interaction is crucial for the activation and proliferation of immune cells, including B cells, T cells, and dendritic cells. By inhibiting this interaction, Cifurtilimab Biosimilar can modulate the immune response and potentially treat various autoimmune and inflammatory diseases.

Moreover, Cifurtilimab Biosimilar has been shown to induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). This means that the antibody can recruit immune cells and activate the complement system to eliminate target cells expressing CD40. This mechanism of action has potential in cancer therapy, as CD40 is overexpressed on the surface of many cancer cells.

Applications of Cifurtilimab Biosimilar

The potential applications of Cifurtilimab Biosimilar are vast, with ongoing research and clinical trials in various disease areas. One of the primary uses of this antibody is in the treatment of autoimmune diseases, such as systemic lupus erythematosus (SLE) and rheumatoid arthritis (RA). By blocking the CD40-CD154 interaction, Cifurtilimab Biosimilar can suppress the overactive immune response and reduce inflammation in these conditions.

In addition, Cifurtilimab Biosimilar has shown promising results in cancer therapy. In preclinical studies, the antibody has demonstrated anti-tumor activity in various cancer types, including lymphoma, melanoma, and breast cancer. Clinical trials are underway to evaluate the efficacy and safety of Cifurtilimab Biosimilar in combination with other cancer treatments, such as chemotherapy and immune checkpoint inhibitors.

Furthermore, Cifurtilimab Biosimilar has potential in the prevention of transplant rejection. By targeting CD40, the antibody can inhibit the activation of immune cells that lead to rejection of transplanted organs. This has been demonstrated in animal studies, and further research is needed to evaluate its effectiveness in human transplants.

Conclusion

Cifurtilimab Biosimilar, also known as Anti-CD40 mAb, is a promising therapeutic antibody with a unique mechanism of action. Its ability to block the CD40-CD154 interaction and induce immune-mediated cytotoxicity makes it a potential treatment for various diseases, including autoimmune disorders and cancer. Ongoing research and clinical trials will provide further insights into the efficacy and safety of Cifurtilimab Biosimilar, and it may become a valuable addition to the arsenal of immunotherapies in the near future.

SDS-PAGE for Cifurtilimab Biosimilar - Anti-CD40 mAb - Research Grade

SDS-PAGE for Cifurtilimab Biosimilar - Anti-CD40 mAb - Research Grade

Cifurtilimab Biosimilar - Anti-CD40 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Cifurtilimab Biosimilar - Anti-CD40 mAb - Research Grade

There are no reviews yet.

Be the first to review “Cifurtilimab Biosimilar – Anti-CD40 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products