Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 20ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human IL6 Recombinant Protein |
|---|---|
| Uniprot ID | P05231 |
| Uniprot link | http://www.uniprot.org/uniprot/P05231 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK |
| Molecular weight | 49.8 kDa |
| Purity estimated | 95% |
| Buffer | PBS, pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Full-length |
| NCBI Reference | P05231 |
| Aliases /Synonyms | Interleukin 6, IL-6, MGI2-A, MGI2A, HGF, BSF2, HSF, IFNB2, B-Cell Stimulatory Factor-2, B-cell stimulatory factor 2, Hybridoma/Plasmacytoma Growth Factor proteins, Hepatocyte Stimulating Factor, Cytotoxic T-Cell Differentiation Factor,CTL differentiation factor, CDF, Hybridoma Growth Factor proteins,Interferon beta-2,IFN-beta-2,BSF-2 |
| Reference | PX-P3013 |
| Note | For research use only. |
Immobilized Human IL6 Recombinant Protein (cat. No.PX-P3013) at 0.5µg/mL (100µL/well) can bind Siltuximab Biosimilar Anti-IL6 mAb (cat. No.PX-TA1029) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 62.18M.
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.