Brand: ProteoGenix

Sirukumab Biosimilar – Anti-IL6 mAb – Research Grade

PX-TA1274-100UG
Validated ELISA

Clonality:: Monoclonal Antibody
Isotype:: IgG1, kappa

Original price was: €248.00.Current price is: €200.00.

100ug 19% OFF + 200 loyalty points

Size Size

50ug Original price was: €178.00.Current price is: €140.00.
100ug Original price was: €248.00.Current price is: €200.00.
1MG Original price was: €563.00.Current price is: €405.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Sirukumab Biosimilar - Anti-IL6 mAb - Research Grade binds to IL6, C-His, recombinant protein in ELISA Assay

Sirukumab Biosimilar - Anti-IL6 mAb - Research Grade

Product name	Sirukumab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID	P05231
Source	CAS 1194585-53-9
Species	Homo sapiens
Expression system	Mammalian cells
Raw Antigen Sequence	MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Sirukumab,CNTO 136,IL6 ,anti-IL6
Reference	PX-TA1274
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1-kappa
Clonality	Monoclonal Antibody

Product name	Sirukumab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID	P05231
Source	CAS 1194585-53-9
Species	Homo sapiens
Expression system	Mammalian cells
Raw Antigen Sequence	MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Sirukumab,CNTO 136,IL6 ,anti-IL6
Reference	PX-TA1274
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1-kappa
Clonality	Monoclonal Antibody

Product name	PX-TA1274-50
Uniprot ID	P05231
Source	CAS 1194585-53-9
Species	Homo sapiens
Expression system	Mammalian cells
Raw Antigen Sequence	MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Aliases /Synonyms	Sirukumab,CNTO 136,IL6 ,anti-IL6
Reference	PX-TA1274
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody

General information on Anti-IL6 [Homo sapiens] (Sirukumab) Monoclonal Antibody

Sirukumab has been investigated for the treatment and basic science of Giant Cell Arteritis and Arthritis, and Rheumatoid.

Sirukumab Biosimilar - Anti-IL6 mAb - Research Grade binds to IL6, C-His, recombinant protein in ELISA Assay

IL6, C-His, recombinant protein(cat. No.PX-P5793) at 0.5Âµg/mL (100ÂµL/well) can bind Sirukumab Biosimilar - Anti-IL6 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Sirukumab Biosimilar - Anti-IL6 mAb - Research Grade

Sirukumab Biosimilar - Anti-IL6 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.