Brand: ProteoGenix

Clazakizumab Biosimilar – Anti-IL6 mAb – Research Grade

PX-TA1288-100UG
Validated ELISA FC WB

Clonality:: Monoclonal Antibody
Isotype:: IgG1, kappa

Original price was: €254.00.Current price is: €200.00.

100ug 21% OFF + 200 loyalty points

Size Size

50ug Original price was: €192.00.Current price is: €140.00.
100ug Original price was: €254.00.Current price is: €200.00.
1MG Original price was: €510.00.Current price is: €405.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Clazakizumab Biosimilar - Anti-IL6 mAb binds to Human IL6 recombinant protein (Met 1~Met212) in indirect ELISA Assay

Clazakizumab Biosimilar - Anti-IL6 mAb - Research Grade

Product name	Clazakizumab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID	P05231
Source	CAS 1236278-28-6
Species	Humanized
Expression system	Mammalian cells
Raw Antigen Sequence	MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Clazakizumab,ALD-518,BMS-945429,IL6,anti-IL6
Reference	PX-TA1288
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1-kappa
Clonality	Monoclonal Antibody

Product name	Clazakizumab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID	P05231
Source	CAS 1236278-28-6
Species	Humanized
Expression system	Mammalian cells
Raw Antigen Sequence	MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Clazakizumab,ALD-518,BMS-945429,IL6,anti-IL6
Reference	PX-TA1288
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1-kappa
Clonality	Monoclonal Antibody

Product name	PX-TA1288-50
Uniprot ID	P05231
Source	CAS 1236278-28-6
Species	Humanized
Expression system	Mammalian cells
Raw Antigen Sequence	MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Aliases /Synonyms	Clazakizumab,ALD-518,BMS-945429,IL6,anti-IL6
Reference	PX-TA1288
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody

General information on Anti-IL6[Homo sapiens] (Clazakizumab) Monoclonal Antibody

Clazakizumab has been investigated the treatment of Rheumatoid Arthritis.

Clazakizumab Biosimilar - Anti-IL6 mAb binds to Human IL6 recombinant protein (Met 1~Met212) in indirect ELISA Assay

Immobilized Human IL6 recombinant protein (Met 1~Met212) (cat. No.PX-P5129) at 0.5µg/mL (100µL/well) can bind to Clazakizumab Biosimilar - Anti-IL6 mAb (cat. No.PX-TA1288) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Clazakizumab Biosimilar - Anti-IL6 mAb - Research Grade binds to IL6, C-His, recombinant protein in WB Assay

IL6, C-His, recombinant protein(cat. No.PX-P5793) can bind Clazakizumab Biosimilar - Anti-IL6 mAb - Research Grade in Western Blot Assay as detected on gel analysis.