Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Clazakizumab Biosimilar – Anti-IL6 mAb – Research Grade

  • PX-TA1288-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €192.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Clazakizumab Biosimilar - Anti-IL6 mAb - Research Grade

Product name Clazakizumab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID P05231
Source CAS 1236278-28-6
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Clazakizumab,ALD-518,BMS-945429,IL6,anti-IL6
Reference PX-TA1288
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Clazakizumab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID P05231
Source CAS 1236278-28-6
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Clazakizumab,ALD-518,BMS-945429,IL6,anti-IL6
Reference PX-TA1288
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1288-50
Uniprot ID P05231
Source CAS 1236278-28-6
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Clazakizumab,ALD-518,BMS-945429,IL6,anti-IL6
Reference PX-TA1288
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-IL6[Homo sapiens] (Clazakizumab) Monoclonal Antibody

Clazakizumab has been investigated the treatment of Rheumatoid Arthritis.

Clazakizumab Biosimilar - Anti-IL6 mAb binds to Human IL6 recombinant protein (Met 1~Met212) in indirect ELISA Assay

Clazakizumab Biosimilar - Anti-IL6 mAb binds to Human IL6 recombinant protein (Met 1~Met212) in indirect ELISA Assay

Immobilized Human IL6 recombinant protein (Met 1~Met212) (cat. No.PX-P5129) at 0.5µg/mL (100µL/well) can bind to Clazakizumab Biosimilar - Anti-IL6 mAb (cat. No.PX-TA1288) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Clazakizumab Biosimilar - Anti-IL6 mAb - Research Grade binds to IL6, C-His, recombinant protein in WB Assay

Clazakizumab Biosimilar - Anti-IL6 mAb - Research Grade binds to IL6, C-His, recombinant protein in WB Assay

IL6, C-His, recombinant protein(cat. No.PX-P5793) can bind Clazakizumab Biosimilar - Anti-IL6 mAb - Research Grade in Western Blot Assay as detected on gel analysis.

Clazakizumab Biosimilar - Anti-IL6 mAb - Research Grade

There are no reviews yet.

Be the first to review “Clazakizumab Biosimilar – Anti-IL6 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products