Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Elsilimomab Biosimilar – Anti-IL6 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: €169.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Elsilimomab Biosimilar - Anti-IL6 mAb - Research Grade

Product name Elsilimomab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID P05231
Source CAS 468715-71-1
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Elsilimomab,B-E8,IL6,anti-IL6
Reference PX-TA1192
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Elsilimomab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID P05231
Source CAS 468715-71-1
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Elsilimomab,B-E8,IL6,anti-IL6
Reference PX-TA1192
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1192-50
Uniprot ID P05231
Source CAS 468715-71-1
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Elsilimomab,B-E8,IL6,anti-IL6
Reference PX-TA1192
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

Introduction to Elsilimomab Biosimilar – Anti-IL6 mAb – Research Grade

Elsilimomab Biosimilar, also known as Anti-IL6 mAb, is a research grade antibody that specifically targets the cytokine Interleukin-6 (IL-6). This biosimilar is designed to mimic the structure and function of the original Elsilimomab antibody, making it a valuable tool for scientific research and potential therapeutic applications. In this article, we will explore the structure, activity, and potential applications of Elsilimomab Biosimilar in more detail.

Structure of Elsilimomab Biosimilar

Elsilimomab Biosimilar is a monoclonal antibody, meaning it is produced by a single clone of immune cells. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The heavy and light chains each contain variable regions, which are responsible for binding to the target IL-6, and constant regions, which determine the antibody’s effector functions.

The variable regions of Elsilimomab Biosimilar are designed to have a high affinity for IL-6, allowing for specific and tight binding. This is crucial for its activity as a research grade antibody, as it enables precise detection and manipulation of IL-6 in experimental settings.

Activity of Elsilimomab Biosimilar

The main activity of Elsilimomab Biosimilar is its ability to bind to IL-6 and block its signaling. IL-6 is a pro-inflammatory cytokine that plays a key role in immune responses and is implicated in various diseases such as rheumatoid arthritis, inflammatory bowel disease, and certain cancers. By blocking IL-6, Elsilimomab Biosimilar can potentially modulate these diseases and provide therapeutic benefits.

Aside from its neutralizing activity, Elsilimomab Biosimilar also has effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These functions can enhance the antibody’s ability to eliminate cells that overexpress IL-6, making it a potential treatment option for IL-6-driven cancers.

Title: Potential Applications of Elsilimomab Biosimilar

Elsilimomab Biosimilar has a wide range of potential applications in scientific research and therapeutic development. As a research grade antibody, it can be used in various techniques such as ELISA, Western blotting, and immunohistochemistry to detect and quantify IL-6 levels in biological samples. This can provide valuable insights into the role of IL-6 in different diseases and aid in the development of new treatments.

In terms of therapeutic applications, Elsilimomab Biosimilar has shown promising results in pre-clinical studies for the treatment of IL-6-driven diseases. For example, in a mouse model of rheumatoid arthritis, treatment with Elsilimomab Biosimilar significantly reduced joint inflammation and destruction. It has also shown potential in treating IL-6-positive cancers, with studies demonstrating its ability to inhibit tumor growth and improve survival rates.

Conclusion

In conclusion, Elsilimomab Biosimilar – Anti-IL6 mAb – Research Grade is a valuable tool for scientific research and has potential therapeutic applications. Its specific structure and activity make it an effective antibody for targeting IL-6, a cytokine involved in various diseases. With further research and development, Elsilimomab Biosimilar has the potential to improve the treatment options for IL-6-driven diseases and contribute to our understanding of the role of IL-6 in health and disease.

SDS-PAGE for Elsilimomab Biosimilar - Anti-IL6 mAb - Research Grade

SDS-PAGE for Elsilimomab Biosimilar - Anti-IL6 mAb - Research Grade

Elsilimomab Biosimilar - Anti-IL6 mAb - Research Grade , on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Elsilimomab Biosimilar - Anti-IL6 mAb - Research Grade

There are no reviews yet.

Be the first to review “Elsilimomab Biosimilar – Anti-IL6 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products