Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ziltivekimab Biosimilar – Anti-IL6 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €195.00.Current price is: €140.00.

50ug 28% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Ziltivekimab Biosimilar - Anti-IL6 mAb - Research Grade

Product name Ziltivekimab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID P05231
Source CAS 2226654-05-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ziltivekimab ,COR-001,IL6 ,anti-IL6
Reference PX-TA1613
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Ziltivekimab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID P05231
Source CAS 2226654-05-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ziltivekimab ,COR-001,IL6 ,anti-IL6
Reference PX-TA1613
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1613-50
Uniprot ID P05231
Source CAS 2226654-05-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ziltivekimab ,COR-001,IL6 ,anti-IL6
Reference PX-TA1613
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Ziltivekimab Biosimilar is a novel anti-IL6 monoclonal antibody (mAb) that has been developed for therapeutic use. It is a research grade antibody that is designed to target and block the activity of interleukin-6 (IL-6), a pro-inflammatory cytokine that plays a critical role in various diseases.

Structure of Ziltivekimab Biosimilar

Ziltivekimab Biosimilar is a fully humanized IgG1 monoclonal antibody that is produced using recombinant DNA technology. It is composed of two heavy chains and two light chains, each consisting of variable and constant regions. The variable regions are responsible for binding to IL-6, while the constant regions are important for effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Mechanism of Action

Ziltivekimab Biosimilar works by binding to IL-6 and preventing it from interacting with its receptors. IL-6 is a key mediator of inflammation and is involved in various physiological processes, including immune response, hematopoiesis, and tissue regeneration. However, excessive or dysregulated production of IL-6 has been linked to the pathogenesis of several diseases, such as rheumatoid arthritis, systemic lupus erythematosus, and inflammatory bowel disease. By blocking IL-6 activity, Ziltivekimab Biosimilar helps to reduce inflammation and improve disease symptoms.

Applications of Ziltivekimab Biosimilar

Ziltivekimab Biosimilar has potential therapeutic applications in various inflammatory and autoimmune diseases. It has been studied in preclinical and clinical trials for the treatment of rheumatoid arthritis, systemic lupus erythematosus, and cytokine release syndrome (CRS) associated with chimeric antigen receptor (CAR) T-cell therapy. In addition, Ziltivekimab Biosimilar has shown promising results in a phase II clinical trial for the treatment of COVID-19 patients with severe respiratory distress.

Rheumatoid Arthritis

Rheumatoid arthritis (RA) is a chronic inflammatory disease that affects the joints, causing pain, stiffness, and swelling. IL-6 is a key mediator of joint inflammation in RA, and its levels are elevated in the synovial fluid and serum of RA patients. Ziltivekimab Biosimilar has been shown to effectively reduce disease activity and improve symptoms in RA patients, making it a potential treatment option for this disease.

Systemic Lupus Erythematosus

Systemic lupus erythematosus (SLE) is a systemic autoimmune disease that can affect multiple organs and tissues. IL-6 has been implicated in the pathogenesis of SLE, and its levels are elevated in SLE patients. Ziltivekimab Biosimilar has shown promising results in reducing disease activity and improving symptoms in SLE patients, making it a potential treatment option for this disease.

Cytokine Release Syndrome

Cytokine release syndrome (CRS) is a potentially life-threatening complication that can occur in patients receiving CAR T-cell therapy. It is characterized by a rapid and excessive release of cytokines, including IL-6, which can lead to systemic inflammation and organ damage. Ziltivekimab Biosimilar has been shown to effectively block IL-6 and reduce CRS symptoms in preclinical studies, making it a potential treatment option for this complication.

COVID-19

COVID-19 is a viral respiratory illness caused by the SARS-CoV-2 virus. IL-6 has been identified as a major driver of the cytokine storm that occurs in severe cases of COVID-19, leading to respiratory failure and death. Ziltivekimab Biosimilar has shown promising results in reducing IL-6 levels and improving respiratory function in COVID-19 patients, making it a potential treatment option for this disease.

Conclusion

In conclusion, Ziltivekimab Biosimilar is

SDS-PAGE for Ziltivekimab Biosimilar - Anti-IL6 mAb - Research Grade

SDS-PAGE for Ziltivekimab  Biosimilar - Anti-IL6  mAb - Research Grade

Ziltivekimab Biosimilar - Anti-IL6 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Ziltivekimab Biosimilar - Anti-IL6 mAb - Research Grade binds to IL6, C-His, recombinant protein in ELISA Assay

Ziltivekimab  Biosimilar - Anti-IL6  mAb - Research Grade binds to IL6, C-His, recombinant protein in ELISA Assay

IL6, C-His, recombinant protein(cat. No.PX-P5793) at 0.5µg/mL (100µL/well) can bind Ziltivekimab Biosimilar - Anti-IL6 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Ziltivekimab  Biosimilar - Anti-IL6  mAb - Research Grade

  • Stefano Ministrini — April 15, 2022

    I used this antibody for in vivo blockade of IL-6. It worked as expected and I got interesting results.

Add a review

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products