Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P08887
Molecular weight:
41.12kDa

Original price was: €235.00.Current price is: €210.00.

50ug 11% OFF + 210 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein

Product name Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein
Uniprot ID P08887
Uniprot link http://www.uniprot.org/uniprot/P08887
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPGSHHHHHH
Molecular weight 41.12kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD126, gp80, IL6R, IL-6R-1, IL-6R-Alpha, IL6RA, IL-6 receptor subunit alpha, Membrane glycoprotein 80
Reference PX-P4046
Note For research use only
Molecular Constructor
Partial Yes
Product name Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein
Uniprot ID P08887
Uniprot link http://www.uniprot.org/uniprot/P08887
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPGSHHHHHH
Molecular weight 41.12kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD126, gp80, IL6R, IL-6R-1, IL-6R-Alpha, IL6RA, IL-6 receptor subunit alpha, Membrane glycoprotein 80
Reference PX-P4046
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P4046-1MG
Uniprot ID P08887
Uniprot link http://www.uniprot.org/uniprot/P08887
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPGSHHHHHH
Molecular weight 41.12kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD126, gp80, IL6R, IL-6R-1, IL-6R-Alpha, IL6RA, IL-6 receptor subunit alpha, Membrane glycoprotein 80
Reference PX-P4046
Note For research use only
Molecular Constructor
Partial Yes

General Information aboutHuman CD126/IL6R/Interleukin-6 receptor subunit alpha recombinant protein

A portion of the interleukin 6 receptor, which binds to IL6 with low affinity, but does not transmit signals (PubMed: 28265003). Signal activation must be related to IL6ST. Activation leads to immune response, acute phase response, and regulation of hematopoietic function (possibly). The interaction of membrane-bound IL6R and IL6ST stimulates “classical signaling” and the limited expression of IL6R limits classical IL6 signaling to only a few tissues, such as the liver and some cells of the immune system. In the process of binding of IL6R and soluble IL6R to IL6ST, “anti-signal transmission” is stimulated. Furthermore, when the membrane-bound IL6: IL6R complex on the transmitting cell activates the IL6ST receptor on the adjacent receptor, the “raster signal” will (possibly) occur

Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein

There are no reviews yet.

Be the first to review “Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products