Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Siltuximab Biosimilar – Anti-IL6 mAb – Research Grade

  • PX-TA1029-50
  • Validated ELISA WB
Isotype:
IgG1, kappa

Original price was: €171.00.Current price is: €140.00.

50ug 18% OFF + 140 loyalty points

Siltuximab Anti-IL6 Monoclonal Antibody for Cytokine Research

Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade

Product name Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID P05231
Source DrugBank DB09036
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 145kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Siltuximab,Siltuximab,IL6,anti-IL6
Reference PX-TA1029
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1Kappa
Clonality Monoclonal Antibody
Product name Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID P05231
Source DrugBank DB09036
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 145kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Siltuximab,Siltuximab,IL6,anti-IL6
Reference PX-TA1029
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1Kappa
Clonality Monoclonal Antibody
Product name PX-TA1029-50
Uniprot ID P05231
Source DrugBank DB09036
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 145kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Siltuximab,Siltuximab,IL6,anti-IL6
Reference PX-TA1029
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa

General Information on Siltuximab Anti-IL6 Monoclonal Antibody

The Siltuximab antibody is a chimeric mouse/human monoclonal antibody designed to bind human interleukin-6 (IL-6), a soluble glycoprotein involved in pro-inflammatory signaling pathways.

Siltuximab is widely studied in research involving cytokine signaling, immune response regulation and inflammatory mechanisms. IL-6 is one of the major pro-inflammatory cytokines overexpressed in multiple pathological conditions and is produced by several cell types including T cells, B cells, monocytes, fibroblasts and endothelial cells.

By interacting with membrane-bound or soluble IL-6 receptors (IL6R), IL-6 can trigger multiple biological responses such as B-cell proliferation, vascular endothelial growth factor (VEGF) production and immune system dysregulation.

Siltuximab has been investigated in research related to inflammatory diseases, oncology and cytokine-mediated pathways, including studies involving multicentric Castleman disease (MCD), multiple myeloma and immune response dysregulation

Applications

This anti-IL6 monoclonal antibody is suitable for:

  • cytokine signaling studies
  • ELISA and binding assays
  • antibody characterization
  • immunology research
  • inflammation-related studies
  • cell-based assays

This Siltuximab biosimilar anti-IL6 monoclonal antibody is intended for research use only.

SDS-PAGE for Siltuximab Biosimilar - Anti-IL6 mAb

SDS-PAGE for Siltuximab Biosimilar - Anti-IL6 mAb

Siltuximab Biosimilar - Anti-IL6 mAb, on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Siltuximab Biosimilar- Anti-IL6 mAb binds to Human IL6 in indirect ELISA assay

Siltuximab Biosimilar- Anti-IL6 mAb binds to Human IL6 in indirect ELISA assay

Immobilized Human IL6 Recombinant Protein (cat. No.PX-P3013) at 0.5µg/mL (100µL/well) can bind Siltuximab Biosimilar- Anti-IL6 mAb (cat. No.PX-TA1029) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 62.18M.

Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade

There are no reviews yet.

Be the first to review “Siltuximab Biosimilar – Anti-IL6 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products