Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ifinatamab Biosimilar – Anti-CD276 mAb – Research Grade

  • PX-TA1847-100
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €248.00.Current price is: €200.00.

100ug 19% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade

Product name Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade
Uniprot ID Q5ZPR3
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ifinatamab,,CD276,anti-CD276
Reference PX-TA1847
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade
Uniprot ID Q5ZPR3
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ifinatamab,,CD276,anti-CD276
Reference PX-TA1847
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1847-50
Uniprot ID Q5ZPR3
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ifinatamab,,CD276,anti-CD276
Reference PX-TA1847
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Ifinatamab Biosimilar, also known as Anti-CD276 mAb, is a research grade monoclonal antibody that has shown promising results in the treatment of various cancers. This antibody specifically targets the CD276 protein, which is overexpressed in many types of cancer cells. In this article, we will delve into the structure, activity, and potential applications of Ifinatamab Biosimilar.

Structure of Ifinatamab Biosimilar

Ifinatamab Biosimilar is a monoclonal antibody, meaning it is derived from a single type of immune cell. It is a fully humanized antibody, meaning it is made up of human proteins and is less likely to cause an immune response in patients. The antibody is composed of two identical heavy chains and two identical light chains, which are connected by disulfide bonds. These chains form the Y-shaped structure commonly seen in antibodies.

The variable regions of Ifinatamab Biosimilar are responsible for its specificity towards the CD276 protein. These regions, also known as the antigen-binding regions, are located at the tips of the Y-shaped structure and are highly variable between different antibodies. The constant regions of the antibody are responsible for its effector functions, such as binding to immune cells and activating them to attack cancer cells.

Activity of Ifinatamab Biosimilar

The primary activity of Ifinatamab Biosimilar is its ability to bind to the CD276 protein. CD276, also known as B7-H3, is a cell surface protein that is overexpressed in many types of cancer cells. This protein plays a role in promoting cancer cell growth and survival, making it an attractive target for cancer treatment.

When Ifinatamab Biosimilar binds to CD276, it blocks its activity and prevents it from promoting cancer cell growth. This can lead to the death of cancer cells and inhibit tumor growth. Additionally, the binding of Ifinatamab Biosimilar to CD276 can also activate the immune system to attack cancer cells, further enhancing its anti- cancer activity.

Applications of Ifinatamab Biosimilar

The primary application of Ifinatamab Biosimilar is in the treatment of cancer. It has shown promising results in preclinical studies and is currently being evaluated in clinical trials for various types of cancer, including lung cancer, breast cancer, and ovarian cancer. The ability of Ifinatamab Biosimilar to specifically target CD276 makes it a potentially effective and safe treatment option for these cancers.

Furthermore, Ifinatamab Biosimilar may also have potential applications in immunotherapy. By activating the immune system to attack cancer cells, it can be used in combination with other immunotherapies to enhance their efficacy. This could potentially lead to more effective and personalized treatments for cancer patients.

Conclusion

Ifinatamab Biosimilar, also known as Anti-CD276 mAb, is a research grade monoclonal antibody that specifically targets the CD276 protein. Its structure, activity, and potential applications make it a promising candidate for the treatment of various types of cancer. As research and clinical trials continue, Ifinatamab Biosimilar may play a crucial role in improving outcomes for cancer patients and advancing the field of cancer treatment.

Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade (cat. No.PX-TA1847) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 71.68M.

Flow Cytometry results for Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade

Flow Cytometry results for Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade

There are no reviews yet.

Be the first to review “Ifinatamab Biosimilar – Anti-CD276 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products