Brand: ProteoGenix

CD276 Recombinant Protein

PX-P4125-50
Validated ELISA

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: Q5ZPR3
Molecular weight:: 70kDa

Original price was: €254.00.Current price is: €223.00.

50ug 12% OFF + 223 loyalty points

Met1–Thr461 His

Size Size

50ug Original price was: €254.00.Current price is: €223.00.
100ug Original price was: €367.00.Current price is: €319.00.
1MG Original price was: €1,156.00.Current price is: €925.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb binds to CD276 Recombinant Protein in indirect ELISA Assay

Omburtamab Biosimilar - Anti-CD276; B7-H3; B7RP-2 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Mirzotamab Biosimilar - Anti-CD276;B7-H3 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Datasheet

CD276 Recombinant Protein

Product name	PX-P4125-100
Uniprot ID	Q5ZPR3
Uniprot link	http://www.uniprot.org/uniprot/Q5ZPR3
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMT
Molecular weight	70kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>95% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Thr461
Aliases /Synonyms	B7H3, PSEC0249, UNQ309/PRO352
Reference	PX-P4125
Note	For research use only.
Molecular Constructor	Met1–Thr461 His

Product name	PX-P4125-1MG
Uniprot ID	Q5ZPR3
Uniprot link	http://www.uniprot.org/uniprot/Q5ZPR3
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMT
Molecular weight	70kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>95% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Thr461
Aliases /Synonyms	B7H3, PSEC0249, UNQ309/PRO352
Reference	PX-P4125
Note	For research use only.
Molecular Constructor	Met1–Thr461 His

Product name	PX-P4125-50
Uniprot ID	Q5ZPR3
Uniprot link	http://www.uniprot.org/uniprot/Q5ZPR3
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMT
Molecular weight	70kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>95% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Thr461
Aliases /Synonyms	B7H3, PSEC0249, UNQ309/PRO352
Reference	PX-P4125
Note	For research use only.
Molecular Constructor	Met1–Thr461 His

General information on CD276 Recombinant Protein:

CD276, also known as B7-H3, is a member of the B superfamily and has IgV and IgG regions in the extracellular domain. It is a type I transmembrane protein with 20-27% amino acid identity to other members of the B7 family. B7-H3 participates in the activation of T lymphocytes and regulates the formation of mouse bone. It has also been reported that B7-H3 may play an important role in muscle-immune interaction, providing further evidence for the active role of muscle cells in the local immune regulation process. B7-H3 is expressed on T cells, natural lethal cells and antigenic cells, and certain non-immune cells (such as osteoblasts, fibroblasts, fibroblast-like synovial cells, and epithelial cells). The high expression of B7-H3 in the tumor vasculature also indicates poor patient survival, indicating that it may play a role in the migration of tumor cells.

Datasheet

Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb binds to CD276 Recombinant Protein in indirect ELISA Assay

Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind to Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb (cat. No.PX-TA1410) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Omburtamab Biosimilar - Anti-CD276; B7-H3; B7RP-2 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind Omburtamab Biosimilar - Anti-CD276; B7-H3; B7RP-2 mAb - Research Grade (cat. No.PX-TA1532) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 13.01M.

Mirzotamab Biosimilar - Anti-CD276;B7-H3 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind Mirzotamab Biosimilar - Anti-CD276;B7-H3 mAb - Research Grade (cat. No.PX-TA1596) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 7.969M.

Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade (cat. No.PX-TA1847) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 71.68M.