Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Slit homolog 2 protein(SLIT2)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
O94813
Molecular weight:
26.50kDa

Original price was: €224.00.Current price is: €182.00.

50ug 19% OFF + 182 loyalty points
Leu271–Cys478
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Slit homolog 2 protein(SLIT2)

Product name Slit homolog 2 protein(SLIT2)
Uniprot ID O94813
Uniprot link http://www.uniprot.org/uniprot/O94813
Expression system Prokaryotic expression
Raw Antigen Sequence LHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRC
Molecular weight 26.50kDa
Purity estimated >80% by SDS-PAGE
Buffer PBS PH7.5, 4M urea 
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu271-Cys478
Aliases /Synonyms SLIL3,Slit-2
Reference PX-P4478
Note For research use only
Molecular Constructor
Leu271–Cys478
Product name Slit homolog 2 protein(SLIT2)
Uniprot ID O94813
Uniprot link http://www.uniprot.org/uniprot/O94813
Expression system Prokaryotic expression
Raw Antigen Sequence LHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRC
Molecular weight 26.50kDa
Purity estimated >80% by SDS-PAGE
Buffer PBS PH7.5, 4M urea 
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu271-Cys478
Aliases /Synonyms SLIL3,Slit-2
Reference PX-P4478
Note For research use only
Molecular Constructor
Leu271–Cys478
Product name PX-P4478-1MG
Uniprot ID O94813
Uniprot link http://www.uniprot.org/uniprot/O94813
Expression system Prokaryotic expression
Raw Antigen Sequence LHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRC
Molecular weight 26.50kDa
Purity estimated >80% by SDS-PAGE
Buffer PBS PH7.5, 4M urea 
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu271-Cys478
Aliases /Synonyms SLIL3,Slit-2
Reference PX-P4478
Note For research use only
Molecular Constructor
Leu271–Cys478

General Information about Slit homolog 2 protein

Slit2 is a member of the Slit family. It can send signals through the Roundabout (Robo) receptor and act as a repellent for axon guidance and neuronal migration. It can also act as a chemotactic factor for vascular endothelial cells and a chemotaxis inhibitor for white blood cells. Slit2 is mainly expressed in the lungs, kidneys and adult spinal cord of fetuses, but less in the adrenal glands, thyroid and trachea of ​​adults. Slit2 was originally synthesized as a precursor of 1499 amino acids, and then cleaved into N-terminal and C-terminal fragments, named Slit2-N and Slit2-C, respectively. As measured by the ability to reject olfactory bulb axons and induce branching in dorsal root ganglion axons, activities related to neurodevelopment are only contained in the N-terminal segment.

Slit homolog 2 protein(SLIT2)

There are no reviews yet.

Be the first to review “Slit homolog 2 protein(SLIT2)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products