Brand: ProteoGenix

Mouse Protein-arginine deiminase type-2 Mouse Recombinant Protein – GST-Tag

PX-P2083-50
Quality Chart

Host species:: Insect
Origin species:: House Mouse
Uniprot ID:: Q08642
Molecular weight:: 102.7 kDa

Original price was: €295.00.Current price is: €259.00.

50ug 12% OFF + 259 loyalty points

Size Size

50ug Original price was: €295.00.Current price is: €259.00.
100ug Original price was: €466.00.Current price is: €416.00.
1MG Original price was: €1,413.00.Current price is: €1,218.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Mouse Protein-arginine deiminase type-2 Mouse Recombinant Protein - GST-Tag

Product name	Mouse Protein-arginine deiminase type-2 Mouse Recombinant Protein - GST-Tag
Uniprot ID	Q08642
Uniprot link	http://www.uniprot.org/uniprot/Q08642
Origin species	House Mouse
Expression system	Eukaryotic expression
Raw Antigen Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDEFMQPPIRENMLRERTVRLQYGSRVEAVYVLGTQL
Molecular weight	102.7 kDa
Protein delivered with Tag?	Yes
Purity estimated	40%
Buffer	PBS,pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Insect
Spec:NCBI Gene Aliases	mKIAA0994, Pdi2, Pdi
Spec:SwissProtID	Q08642
NCBI Reference	NP_032838.2
Aliases /Synonyms	Protein-arginine deiminase type-2 Mouse, peptidyl arginine deiminase, type II, Protein-arginine deiminase type-2 ou Peptidylarginine deiminase II ou Protein-arginine deiminase type II
Reference	PX-P2083
Note	For research use only
Molecular Constructor	Yes

Product name	Mouse Protein-arginine deiminase type-2 Mouse Recombinant Protein - GST-Tag
Uniprot ID	Q08642
Uniprot link	http://www.uniprot.org/uniprot/Q08642
Origin species	House Mouse
Expression system	Eukaryotic expression
Raw Antigen Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDEFMQPPIRENMLRERTVRLQYGSRVEAVYVLGTQL
Molecular weight	102.7 kDa
Protein delivered with Tag?	Yes
Purity estimated	40%
Buffer	PBS,pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Insect
Spec:NCBI Gene Aliases	mKIAA0994, Pdi2, Pdi
Spec:SwissProtID	Q08642
NCBI Reference	NP_032838.2
Aliases /Synonyms	Protein-arginine deiminase type-2 Mouse, peptidyl arginine deiminase, type II, Protein-arginine deiminase type-2 ou Peptidylarginine deiminase II ou Protein-arginine deiminase type II
Reference	PX-P2083
Note	For research use only
Molecular Constructor	Yes

Product name	PX-P2083-1MG
Uniprot ID	Q08642
Uniprot link	http://www.uniprot.org/uniprot/Q08642
Origin species	House Mouse
Expression system	Eukaryotic expression
Raw Antigen Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDEFMQPPIRENMLRERTVRLQYGSRVEAVYVLGTQL
Molecular weight	102.7 kDa
Protein delivered with Tag?	Yes
Purity estimated	40%
Buffer	PBS,pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Insect
Spec:NCBI Gene Aliases	mKIAA0994, Pdi2, Pdi
Spec:SwissProtID	Q08642
NCBI Reference	NP_032838.2
Aliases /Synonyms	Protein-arginine deiminase type-2 Mouse, peptidyl arginine deiminase, type II, Protein-arginine deiminase type-2 ou Peptidylarginine deiminase II ou Protein-arginine deiminase type II
Reference	PX-P2083
Note	For research use only
Molecular Constructor	Yes