Name: Interleukin-10 recombinant protein
SKU: PX-P5130-100
Price: 394.00 EUR
Availability: InStock

Product name	Interleukin-10 recombinant protein
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNLEHHHHHH
Molecular weight	17.71 kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Ser19-Asn178
Protein Accession	P22301
Aliases /Synonyms	IL-10,Cytokine synthesis inhibitory factor,CSIF
Reference	PX-P5130
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Interleukin-10 recombinant protein”

€394.00In stock

Size

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PX-P3032 210€

View product