Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Omburtamab Biosimilar – Anti-CD276, B7-H3, B7RP-2 mAb – Research Grade

  • PX-TA1532-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €190.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Omburtamab Biosimilar - Anti-CD276, B7-H3, B7RP-2 mAb - Research Grade

Product name Omburtamab Biosimilar - Anti-CD276, B7-H3, B7RP-2 mAb - Research Grade
Uniprot ID Q5ZPR3
Source CAS 1895083-75-6
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Omburtamab,8H9,Mab 8H9,CD276, B7-H3, B7RP-2,anti-CD276, B7-H3, B7RP-2
Reference PX-TA1532
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Omburtamab Biosimilar - Anti-CD276, B7-H3, B7RP-2 mAb - Research Grade
Uniprot ID Q5ZPR3
Source CAS 1895083-75-6
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Omburtamab,8H9,Mab 8H9,CD276, B7-H3, B7RP-2,anti-CD276, B7-H3, B7RP-2
Reference PX-TA1532
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1532-50
Uniprot ID Q5ZPR3
Source CAS 1895083-75-6
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Omburtamab,8H9,Mab 8H9,CD276, B7-H3, B7RP-2,anti-CD276, B7-H3, B7RP-2
Reference PX-TA1532
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Omburtamab Biosimilar – Anti-CD276, B7-H3, B7RP-2 mAb

Omburtamab Biosimilar, also known as Anti-CD276, B7-H3, B7RP-2 mAb, is a monoclonal antibody that has been developed as a potential therapeutic agent for various types of cancer. This biosimilar is designed to target the CD276 protein, also known as B7-H3 or B7RP-2, which is overexpressed in many types of cancer cells. In this article, we will explore the structure, activity, and potential applications of Omburtamab Biosimilar.

Structure of Omburtamab Biosimilar

Omburtamab Biosimilar is a recombinant humanized monoclonal antibody that has been engineered to specifically target the CD276 protein. It is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The antibody has a molecular weight of approximately 150 kDa and a half-life of about 21 days.

The binding site of Omburtamab Biosimilar is located on the Fc region of the antibody, which allows for interaction with immune cells and activation of immune responses. The variable regions of the antibody, also known as the antigen-binding sites, are responsible for binding to the CD276 protein on the surface of cancer cells.

Activity of Omburtamab Biosimilar

The main activity of Omburtamab Biosimilar is its ability to bind to the CD276 protein on the surface of cancer cells. This binding triggers a series of immune responses, including antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These responses result in the destruction of cancer cells and inhibition of tumor growth.

In addition, Omburtamab Biosimilar has been shown to have a direct anti-tumor effect by inducing apoptosis, or programmed cell death, in cancer cells. This is achieved by blocking the signaling pathways involved in cancer cell survival and proliferation.

Applications of Omburtamab Biosimilar

Omburtamab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various types of cancer, including neuroblastoma, melanoma, and lung cancer. It has also been investigated for its potential to treat other diseases, such as autoimmune disorders and infectious diseases.

In neuroblastoma, Omburtamab Biosimilar has shown to be effective in targeting and killing cancer cells, while sparing healthy cells. This makes it a potential treatment option for this aggressive form of childhood cancer.

In melanoma, Omburtamab Biosimilar has been shown to enhance the anti-tumor effects of other therapies, such as chemotherapy and immune checkpoint inhibitors. This makes it a promising candidate for combination therapy in the treatment of this deadly form of skin cancer.

In lung

cancer, Omburtamab Biosimilar has shown to be effective in targeting cancer cells that have become resistant to chemotherapy. It has also been shown to enhance the activity of other targeted therapies, such as EGFR inhibitors.

Conclusion

In summary, Omburtamab Biosimilar – Anti-CD276, B7-H3, B7RP-2 mAb – Research Grade is a promising monoclonal antibody that has been designed to target the CD276 protein, which is overexpressed in many types of cancer cells. Its unique structure and activity make it a potential treatment option for various types of cancer, including neuroblastoma, melanoma, and lung cancer. Omburtamab Biosimilar is currently being evaluated in clinical trials and has the potential to improve the outcomes of cancer patients.

Omburtamab Biosimilar - Anti-CD276; B7-H3; B7RP-2 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Omburtamab Biosimilar - Anti-CD276; B7-H3; B7RP-2 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind Omburtamab Biosimilar - Anti-CD276; B7-H3; B7RP-2 mAb - Research Grade (cat. No.PX-TA1532) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 13.01M.

Omburtamab Biosimilar - Anti-CD276, B7-H3, B7RP-2 mAb - Research Grade

There are no reviews yet.

Be the first to review “Omburtamab Biosimilar – Anti-CD276, B7-H3, B7RP-2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products