Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Enoblituzumab Biosimilar – Anti-CD276, B7-H3 mAb – Research Grade

  • PX-TA1410-50
  • Validated ELISA
Isotype:
IgG1, kappa

Original price was: €171.00.Current price is: €140.00.

50ug 18% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb - Research Grade

Product name Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb - Research Grade
Uniprot ID Q5ZPR3
Source CAS 1353485-38-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Enoblituzumab,MG-A271,CD276, B7-H3,anti-CD276, B7-H3
Reference PX-TA1410
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb - Research Grade
Uniprot ID Q5ZPR3
Source CAS 1353485-38-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Enoblituzumab,MG-A271,CD276, B7-H3,anti-CD276, B7-H3
Reference PX-TA1410
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1410-50
Uniprot ID Q5ZPR3
Source CAS 1353485-38-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Enoblituzumab,MG-A271,CD276, B7-H3,anti-CD276, B7-H3
Reference PX-TA1410
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa

General information on Anti-CD276/B7-H3[Homo sapiens] (Enoblituzumab) Monoclonal Antibody

Enoblituzumab is investigated for the treatment of B7-H3-expressing Solid Tumors.

SDS-PAGE for Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb

SDS-PAGE for Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb

Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb binds to CD276 Recombinant Protein in Indirect ELISA Assay

Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb binds to CD276 Recombinant Protein in Indirect ELISA Assay

Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind to Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb (cat. No.PX-TA1410) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

SEC-HPLC of Enoblituzumab Biosimilar - Anti-CD276; B7-H3 mAb - Research Grade

SEC-HPLC of Enoblituzumab Biosimilar - Anti-CD276; B7-H3 mAb - Research Grade

Enoblituzumab Biosimilar - Anti-CD276; B7-H3 mAb - Research Grade was analyzed by size exclusion chromatography with UV detection.

Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Enoblituzumab Biosimilar – Anti-CD276, B7-H3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products