Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Xeligekimab Biosimilar – Anti-IL17 mAb – Research Grade

  • PX-TA1766-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €176.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade

Product name Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade
Uniprot ID Q16552
Source CAS: 2382921-73-3
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Xeligekimab,GR 1501,GR-1501, GR1501,IL17,anti-IL17
Reference PX-TA1766
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade
Uniprot ID Q16552
Source CAS: 2382921-73-3
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Xeligekimab,GR 1501,GR-1501, GR1501,IL17,anti-IL17
Reference PX-TA1766
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1766-50
Uniprot ID Q16552
Source CAS: 2382921-73-3
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Xeligekimab,GR 1501,GR-1501, GR1501,IL17,anti-IL17
Reference PX-TA1766
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Xeligekimab Biosimilar, also known as Anti-IL17 mAb, is a research grade antibody that has shown promising results in targeting and treating various inflammatory and autoimmune diseases. This biosimilar is a monoclonal antibody that specifically targets Interleukin-17 (IL-17), a pro-inflammatory cytokine that plays a key role in the pathogenesis of several diseases. In this article, we will explore the structure, activity and potential applications of Xeligekimab Biosimilar.

Structure of Xeligekimab Biosimilar

Xeligekimab Biosimilar is a recombinant, fully humanized monoclonal antibody that is produced using advanced biotechnology methods. It is a biosimilar of Secukinumab, a well-established anti-IL17 mAb that has been approved for the treatment of psoriasis, psoriatic arthritis, and ankylosing spondylitis. The structure of Xeligekimab Biosimilar is similar to Secukinumab, with a few modifications that make it more suitable for research purposes.

Xeligekimab Biosimilar is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region is responsible for binding to IL-17, while the constant region determines the antibody’s effector functions. The antibody has a molecular weight of approximately 150 kDa and is produced in mammalian cell lines.

Activity of Xeligekimab Biosimilar

Xeligekimab Biosimilar works by specifically targeting and neutralizing IL-17, a cytokine that is involved in the pathogenesis of various inflammatory and autoimmune diseases. IL-17 is produced by a type of immune cell known as Th17 cells and is responsible for recruiting other immune cells to the site of inflammation. This leads to tissue damage and chronic inflammation, which can contribute to the development of diseases such as psoriasis, rheumatoid arthritis, and inflammatory bowel disease.

By binding to IL-17, Xeligekimab Biosimilar prevents it from interacting with its receptors on target cells, thereby inhibiting its pro-inflammatory effects. This results in a reduction of inflammation and alleviation of symptoms associated with IL-17-mediated diseases.

Applications of Xeligekimab Biosimilar

Xeligekimab Biosimilar has shown promising results in pre-clinical studies and is currently being evaluated for its potential applications in various diseases. Some of the potential therapeutic areas where Xeligekimab Biosimilar could be beneficial include:

Psoriasis Psoriasis is a chronic inflammatory skin disease that is characterized by red, scaly patches on the skin. IL-17 plays a key role in the development of psoriasis, and Xeligekimab Biosimilar has shown to be effective in reducing the severity of symptoms in pre-clinical studies.

Rheumatoid Arthritis

Rheumatoid arthritis is an autoimmune disease that causes inflammation and damage to the joints. IL-17 is known to contribute to the development of this disease, and Xeligekimab Biosimilar has shown to be effective in reducing joint inflammation and preventing joint damage in pre-clinical studies.

Inflammatory Bowel Disease

Inflammatory bowel disease (IBD) is a group of chronic inflammatory disorders that affect the digestive tract. IL-17 has been implicated in the pathogenesis of IBD, and Xeligekimab Biosimilar has shown to be effective in reducing intestinal inflammation and improving symptoms in pre-clinical studies.

Other potential applications

Apart from the above-mentioned diseases, Xeligekimab Biosimilar is also being evaluated for its potential in other IL-17-mediated diseases, such as psoriatic arthritis, ankylosing spondylitis, and asthma.

Conclusion

In conclusion, Xeligekimab Biosimilar is a promising research grade antibody that specifically targets IL-17 and has shown potential in treating various inflammatory and

SDS-PAGE for Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade

SDS-PAGE for Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade

Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade in ELISA Assay

Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade in ELISA Assay

Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Xeligekimab Biosimilar - Anti-IL17 mAb - Research Grade

There are no reviews yet.

Be the first to review “Xeligekimab Biosimilar – Anti-IL17 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products