Brand: ProteoGenix

Interleukin-17A(IL17A)

PX-P4824-100
Quality Chart

Host species:: Mammalian cells
Uniprot ID:: Q16552
Molecular weight:: 18.5kDa

Original price was: €487.00.Current price is: €420.00.

100ug 14% OFF + 420 loyalty points

Met1–Ala155 His

Size Size

50ug Original price was: €258.00.Current price is: €210.00.
100ug Original price was: €487.00.Current price is: €420.00.
1MG Original price was: €1,401.00.Current price is: €1,218.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Interleukin-17A(IL17A)

Product name	Interleukin-17A(IL17A)
Uniprot ID	Q16552
Uniprot link	https://www.uniprot.org/uniprot/Q16552
Expression system	Eukaryotic expression
Raw Antigen Sequence	MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Molecular weight	18.5kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>60% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Ala155
Protein Accession	Q16552
Spec:Entrez GeneID	3605
Spec:NCBI Gene Aliases	IL17; CTLA8; IL-17; CTLA-8; IL-17A
Spec:SwissProtID	Q5T2P0
NCBI Reference	Q16552
Aliases /Synonyms	Cytotoxic T-lymphocyte-associated antigen 8,CTLA-8,CTLA8, IL17,IL-17, IL-17A
Reference	PX-P4824
Note	For research use only
Molecular Constructor	Met1–Ala155 His

Product name	Interleukin-17A(IL17A)
Uniprot ID	Q16552
Uniprot link	https://www.uniprot.org/uniprot/Q16552
Expression system	Eukaryotic expression
Raw Antigen Sequence	MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Molecular weight	18.5kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>60% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Ala155
Protein Accession	Q16552
Spec:Entrez GeneID	3605
Spec:NCBI Gene Aliases	IL17; CTLA8; IL-17; CTLA-8; IL-17A
Spec:SwissProtID	Q5T2P0
NCBI Reference	Q16552
Aliases /Synonyms	Cytotoxic T-lymphocyte-associated antigen 8,CTLA-8,CTLA8, IL17,IL-17, IL-17A
Reference	PX-P4824
Note	For research use only
Molecular Constructor	Met1–Ala155 His

Product name	PX-P4824-1MG
Uniprot ID	Q16552
Uniprot link	https://www.uniprot.org/uniprot/Q16552
Expression system	Eukaryotic expression
Raw Antigen Sequence	MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Molecular weight	18.5kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>60% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Ala155
Protein Accession	Q16552
Spec:Entrez GeneID	3605
Spec:NCBI Gene Aliases	IL17; CTLA8; IL-17; CTLA-8; IL-17A
Spec:SwissProtID	Q5T2P0
NCBI Reference	Q16552
Aliases /Synonyms	Cytotoxic T-lymphocyte-associated antigen 8,CTLA-8,CTLA8, IL17,IL-17, IL-17A
Reference	PX-P4824
Note	For research use only
Molecular Constructor	Met1–Ala155 His