Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

IL17A, C-His, recombinant protein

  • PX-P5780
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q16552
Molecular weight:
18.47 kDa

€379.00

100ug + 379 loyalty points
Gly24–Ala155 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

IL17A, C-His, recombinant protein

Product name IL17A, C-His, recombinant protein
Uniprot ID Q16552
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Molecular weight 18.47 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly24-Ala155
Protein Accession Q16552
Reference PX-P5780
Note For research use only.
Molecular Constructor
Gly24–Ala155 His

Secukinumab Biosimilar - Anti-IL17A mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Secukinumab Biosimilar - Anti-IL17A mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind to Secukinumab Biosimilar - Anti-IL17A mAb (cat. No.PX-TA1234) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade (cat. No.PX-TA1444) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 3.347M.

Netakimab Biosimilar - Anti-IL17A mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Netakimab Biosimilar - Anti-IL17A mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind Netakimab Biosimilar - Anti-IL17A mAb - Research Grade (cat. No.PX-TA1499) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 1.931M.

Tibulizumab Biosimilar - Anti-IL17A, TNFSF13B, CD257 mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Tibulizumab Biosimilar - Anti-IL17A, TNFSF13B, CD257 mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind Tibulizumab Biosimilar - Anti-IL17A, TNFSF13B, CD257 mAb - Research Grade (cat. No.PX-TA1494) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 129.6M.

Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind to Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb (cat. No.PX-TA1342) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Ixekizumab Biosimilar - Anti-IL17A mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Ixekizumab Biosimilar - Anti-IL17A mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind to Ixekizumab Biosimilar - Anti-IL17A mAb (cat. No.PX-TA1022) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

IL17A, C-His, recombinant protein

There are no reviews yet.

Be the first to review “IL17A, C-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products