Name: Human Serum amyloid A-1 protein(SAA1) Recombinant Protein
SKU: PX-P3003-10
Availability: InStock

Product name	Human Serum amyloid A-1 protein(SAA1) Recombinant Protein
Uniprot ID	P0DJI8
Uniprot link	http://www.uniprot.org/uniprot/P0DJI8
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MNHKVHHHHHHMRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Molecular weight	13.2 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	Tris-HC 50mMl, NaCl 150mM, pH7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Partial
Spec:NCBI Gene Aliases	SAA1
NCBI Reference	P0DJI8
Aliases /Synonyms	Serum amyloid A-1 protein, SAA, Amyloid fibril protein AA
Reference	PX-P3003
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human Serum amyloid A-1 protein(SAA1) Recombinant Protein”

Size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PX-TA1428 400€

View product

Biosimilar

PX-TA1775 400€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.