Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anselamimab Biosimilar – Anti-Serum amyloid A-1 mAb – Research Grade

  • PX-TA1775-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €189.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anselamimab Biosimilar - Anti-Serum amyloid A-1 mAb - Research Grade

Product name Anselamimab Biosimilar - Anti-Serum amyloid A-1 mAb - Research Grade
Uniprot ID P0DJI8
Source CAS: 2414866-63-8
Species Chimeric
Expression system XtenCHO
Raw Antigen Sequence MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Anselamimab,11-1F4,,Serum amyloid A-1,anti-Serum amyloid A-1
Reference PX-TA1775
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Anselamimab Biosimilar - Anti-Serum amyloid A-1 mAb - Research Grade
Uniprot ID P0DJI8
Source CAS: 2414866-63-8
Species Chimeric
Expression system XtenCHO
Raw Antigen Sequence MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Anselamimab,11-1F4,,Serum amyloid A-1,anti-Serum amyloid A-1
Reference PX-TA1775
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1775-50
Uniprot ID P0DJI8
Source CAS: 2414866-63-8
Species Chimeric
Expression system XtenCHO
Raw Antigen Sequence MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Anselamimab,11-1F4,,Serum amyloid A-1,anti-Serum amyloid A-1
Reference PX-TA1775
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Anselamimab Biosimilar, also known as Anti-Serum amyloid A-1 mAb, is a research grade antibody that has shown promising results in the treatment of various inflammatory diseases. This biosimilar is a monoclonal antibody that specifically targets Serum amyloid A-1 (SAA-1), a protein that plays a crucial role in the development and progression of inflammatory conditions. In this article, we will delve deeper into the structure, activity, and potential applications of Anselamimab Biosimilar.

Structure of Anselamimab Biosimilar

Anselamimab Biosimilar is a recombinant monoclonal antibody that is produced using advanced genetic engineering techniques. It is a fully humanized antibody, meaning that it is derived from human cells and has a structure identical to that of natural human antibodies. This makes it less likely to cause an immune response in patients, making it a safer and more effective treatment option.

The antibody consists of two heavy chains and two light chains, which are linked together by disulfide bonds. The heavy chains are responsible for binding to the target protein, SAA-1, while the light chains provide stability and contribute to the overall structure of the antibody.

Activity of Anselamimab Biosimilar

Anselamimab Biosimilar works by binding to SAA-1 and preventing it from interacting with its receptors on immune cells. This action inhibits the inflammatory response triggered by SAA-1, thus reducing inflammation and tissue damage in various diseases. Additionally, the binding of Anselamimab Biosimilar to SAA-1 also leads to the clearance of excess SAA-1 from the body, further reducing its levels and potential harmful effects.

Studies have shown that Anselamimab Biosimilar has a high affinity for SAA-1, meaning that it binds to it with a strong and specific interaction. This allows for a targeted and effective treatment approach, minimizing potential side effects and maximizing therapeutic benefits.

Applications of Anselamimab Biosimilar

The primary therapeutic target of Anselamimab Biosimilar is SAA-1, which is implicated in various inflammatory diseases such as rheumatoid arthritis, systemic lupus erythematosus, and inflammatory bowel disease. By inhibiting the activity of SAA-1, Anselamimab Biosimilar has shown promising results in reducing disease severity and improving patient outcomes in clinical trials.

Moreover, Anselamimab Biosimilar has also shown potential in the treatment of cardiovascular diseases, as SAA-1 is also involved in the development of atherosclerosis and other cardiovascular complications. By targeting SAA-1, Anselamimab Biosimilar may help to reduce the risk of cardiovascular events and improve overall cardiovascular health.

Conclusion

Anselamimab Biosimilar is a research grade antibody that specifically targets SAA-1, a protein involved in the development and progression of various inflammatory diseases. Its structure, activity, and potential applications make it a promising candidate for the treatment of these conditions. Further research and clinical trials are needed to fully understand the potential of Anselamimab Biosimilar and its role in improving patient outcomes.

SEC-HPLC of Anselamimab Biosimilar - Anti-Serum amyloid A-1 mAb - Research Grade

SEC-HPLC of Anselamimab Biosimilar - Anti-Serum amyloid A-1 mAb - Research Grade

Anselamimab Biosimilar - Anti-Serum amyloid A-1 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Anselamimab Biosimilar - Anti-Serum amyloid A-1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Anselamimab Biosimilar – Anti-Serum amyloid A-1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products