Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Birtamimab Biosimilar – Anti-SAA1 mAb – Research Grade

  • PX-TA1428-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €272.00.Current price is: €200.00.

100ug 26% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Birtamimab Biosimilar - Anti-SAA1 mAb - Research Grade

Product name Birtamimab Biosimilar - Anti-SAA1 mAb - Research Grade
Uniprot ID P0DJI8
Source CAS 1608108-91-3
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Birtamimab,2A4,ELT1-01,NEOD-001,SAA1,anti-SAA1
Reference PX-TA1428
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Birtamimab Biosimilar - Anti-SAA1 mAb - Research Grade
Uniprot ID P0DJI8
Source CAS 1608108-91-3
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Birtamimab,2A4,ELT1-01,NEOD-001,SAA1,anti-SAA1
Reference PX-TA1428
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1428-50
Uniprot ID P0DJI8
Source CAS 1608108-91-3
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Birtamimab,2A4,ELT1-01,NEOD-001,SAA1,anti-SAA1
Reference PX-TA1428
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-SAA1[Homo sapiens] (Birtamimab) Monoclonal Antibody

Birtamimab is investigated for the treatment of AL Amyloidosis.

SDS-PAGE for Birtamimab Biosimilar - Anti-SAA1 mAb

SDS-PAGE for Birtamimab Biosimilar - Anti-SAA1 mAb

Birtamimab Biosimilar - Anti-SAA1 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Birtamimab Biosimilar - Anti-SAA mAb - Research Grade binds to Recombinant Human SAA1 Protein, N-His in ELISA Assay

Birtamimab Biosimilar - Anti-SAA mAb - Research Grade binds to Recombinant Human SAA1 Protein, N-His in ELISA Assay

Recombinant Human SAA1 Protein, N-His(cat. No.ARO-P10428) at 0.5µg/mL (100µL/well) can bind Birtamimab Biosimilar - Anti-SAA mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Birtamimab Biosimilar - Anti-SAA1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Birtamimab Biosimilar – Anti-SAA1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products