Name: CD70 antigen (CD70)
SKU: PX-P4642-10
Availability: InStock

Product name	CD70 antigen (CD70)
Uniprot ID	P32970
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MGSHHHHHHSGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Gln39-Pro193
Aliases /Synonyms	CD27 ligand,CD27-L,Tumor necrosis factor ligand superfamily member 7,CD70,CD27L, CD27LG, TNFSF7
Reference	PX-P4642
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “CD70 antigen (CD70)”

Size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PX-TA1304 400€

View product

Biosimilar

PX-TA1500 400€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.