Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cusatuzumab Biosimilar – Anti-CD70, TNFSF7 mAb – Research Grade

  • PX-TA1500-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: €274.00.Current price is: €200.00.

100ug 27% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Cusatuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade

Product name Cusatuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade
Uniprot ID P32970
Source CAS 1399546-01-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Cusatuzumab,ARGX-110,CD70, TNFSF7,anti-CD70, TNFSF7
Reference PX-TA1500
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Cusatuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade
Uniprot ID P32970
Source CAS 1399546-01-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Cusatuzumab,ARGX-110,CD70, TNFSF7,anti-CD70, TNFSF7
Reference PX-TA1500
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1500-50
Uniprot ID P32970
Source CAS 1399546-01-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Cusatuzumab,ARGX-110,CD70, TNFSF7,anti-CD70, TNFSF7
Reference PX-TA1500
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Cusatuzumab Biosimilar: An Anti-CD70, TNFSF7 mAb for Targeted Therapy

Cusatuzumab Biosimilar, also known as anti-CD70 or TNFSF7 monoclonal antibody, is a research grade biologic drug that has shown promising results in the treatment of various cancers. This biosimilar is a replica of the original drug, Cusatuzumab, which was developed by the pharmaceutical company Novartis. The biosimilar version is being developed by various companies for its potential use as a more affordable and accessible alternative for patients.

Structure of Cusatuzumab Biosimilar

Cusatuzumab Biosimilar is a monoclonal antibody that specifically targets CD70, a protein found on the surface of cancer cells. It is a humanized IgG1 kappa antibody, meaning it is made up of human and mouse components to reduce the risk of immune reactions. The antibody has a molecular weight of approximately 150 kDa and consists of two heavy and two light chains, connected by disulfide bonds.

The binding site of Cusatuzumab Biosimilar is located on the variable region of the heavy chain, which allows it to bind to CD70 with high specificity and affinity. This binding triggers a series of immune responses that ultimately lead to the destruction of cancer cells.

Mechanism of Action

The main therapeutic target of Cusatuzumab Biosimilar is CD70, a protein that is overexpressed in many types of cancer, including solid tumors and hematologic malignancies. CD70 is a member of the tumor necrosis factor (TNF) superfamily and plays a crucial role in the proliferation and survival of cancer cells.

When Cusatuzumab Biosimilar binds to CD70, it blocks its interaction with its receptor, CD27, which is expressed on the surface of immune cells. This prevents the activation of the CD70-CD27 pathway, which is responsible for promoting cancer cell growth and survival. In addition, the binding of Cusatuzumab Biosimilar to CD70 also triggers the immune system to recognize and attack cancer cells, further enhancing its anti-tumor activity.

Applications of Cusatuzumab Biosimilar

The primary application of Cusatuzumab Biosimilar is in the treatment of cancer. It has shown promising results in preclinical and clinical studies for various types of cancer, including acute myeloid leukemia, multiple myeloma, and solid tumors such as renal cell carcinoma and non-small cell lung cancer.

In addition to its use as a monotherapy, Cusatuzumab Biosimilar has also been studied in combination with other anti- cancer drugs, such as chemotherapy and immune checkpoint inhibitors. These combination therapies have shown synergistic effects and have the potential to further improve treatment outcomes for cancer patients.

Conclusion

Cusatuzumab Biosimilar is a promising biologic drug with a unique mechanism of action that specifically targets CD70, a protein involved in the growth and survival of cancer cells. Its potential as a more affordable and accessible alternative to the original drug makes it an attractive option for cancer treatment. With ongoing research and clinical trials, Cusatuzumab Biosimilar has the potential to become a valuable addition to the arsenal of anti- cancer therapies.

Keywords: Cusatuzumab Biosimilar, anti-CD70, TNFSF7 mAb, monoclonal antibody, cancer, therapeutic target

SDS-PAGE for Cusatuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade

SDS-PAGE for Cusatuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade

Cusatuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Cusatuzumab Biosimilar - Anti-CD70; TNFSF7 mAb - Research Grade in ELISA Assay

Cusatuzumab Biosimilar - Anti-CD70; TNFSF7 mAb - Research Grade in ELISA Assay

Cusatuzumab Biosimilar - Anti-CD70; TNFSF7 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Cusatuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade

There are no reviews yet.

Be the first to review “Cusatuzumab Biosimilar – Anti-CD70, TNFSF7 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products