Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Guselkumab Biosimilar – Anti-IL23A mAb – Research Grade

Isotype:
IgG1, lambda

Original price was: €118.00.Current price is: €84.00.

50ug 29% OFF + 84 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Guselkumab Biosimilar - Anti-IL23A mAb - Research Grade

Product name Guselkumab Biosimilar - Anti-IL23A mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS 1350289-85-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Molecular weight 143kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Guselkumab,CNTO-1959,IL23A,anti-IL23A
Reference PX-TA1327
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Product name Guselkumab Biosimilar - Anti-IL23A mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS 1350289-85-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Molecular weight 143kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Guselkumab,CNTO-1959,IL23A,anti-IL23A
Reference PX-TA1327
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Product name PX-TA1327-50
Uniprot ID Q9NPF7
Source CAS 1350289-85-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Molecular weight 143kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Guselkumab,CNTO-1959,IL23A,anti-IL23A
Reference PX-TA1327
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Product name Guselkumab Biosimilar - Anti-IL23A mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS 1350289-85-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Molecular weight 143kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Guselkumab,CNTO-1959,IL23A,anti-IL23A
Reference PX-TA1327
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Guselkumab Biosimilar - Anti-IL23A mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS 1350289-85-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Molecular weight 143kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Guselkumab,CNTO-1959,IL23A,anti-IL23A
Reference PX-TA1327
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody

General information on Anti-IL23A[Homo sapiens] (Guselkumab) Monoclonal Antibody

Guselkumab is a human IgG1 lambda monoclonal antibody that targets interleukin-23. IL-23 is an inflammatory cytokine that is reponsible for the activation of the CD4+ T-helper (Th17) cell pathway in the inflammatory cascade that induces psoriatic plaque formation. Guselkumab has been used to treat psoriasis. It has been sold under the trade name Tremfya.

SDS-PAGE for Guselkumab Biosimilar - Anti-IL23A mAb

SDS-PAGE for Guselkumab Biosimilar - Anti-IL23A mAb

Guselkumab Biosimilar - Anti-IL23A mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Guselkumab Biosimilar - Anti-IL23A mAb - Research Grade

There are no reviews yet.

Be the first to review “Guselkumab Biosimilar – Anti-IL23A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products