Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Favezelimab Biosimilar – Anti-LAG3 mAb – Research Grade

  • PX-TA1838-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €188.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade

Product name Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade
Uniprot ID P18627
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Favezelimab,,LAG3,anti-LAG3
Reference PX-TA1838
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Kappa
Clonality Monoclonal Antibody
Product name Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade
Uniprot ID P18627
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Favezelimab,,LAG3,anti-LAG3
Reference PX-TA1838
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1838-50
Uniprot ID P18627
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Favezelimab,,LAG3,anti-LAG3
Reference PX-TA1838
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Favezelimab Biosimilar: A Promising Anti-LAG3 Monoclonal Antibody for

Cancer Therapy Introduction

Favezelimab Biosimilar, also known as Anti-LAG3 mAb, is a novel monoclonal antibody (mAb) that targets the Lymphocyte Activation Gene 3 (LAG3) protein. This protein is a cell surface receptor found on various immune cells, including T cells, B cells, and natural killer (NK) cells. LAG3 plays a crucial role in regulating immune responses and has been identified as a potential therapeutic target for cancer treatment. Favezelimab Biosimilar is a research-grade version of the therapeutic antibody and is currently in preclinical development for the treatment of various types of cancer.

Structure of Favezelimab Biosimilar

Favezelimab Biosimilar is a fully humanized IgG1 monoclonal antibody, meaning it is derived from human genetic material and has a constant region of the heavy chain that is of the IgG1 isotype. This structure allows the antibody to effectively engage with the immune system and exert its therapeutic effects. The variable region of the antibody specifically binds to the LAG3 protein, preventing its interaction with its ligands and inhibiting downstream signaling pathways.

Mechanism of Action

The primary mechanism of action of Favezelimab Biosimilar is through the blockade of LAG3 signaling. LAG3 is known to negatively regulate T cell activation and function, and its overexpression has been linked to immune evasion and tumor progression in various cancers. By binding to LAG3, Favezelimab Biosimilar prevents its interaction with major histocompatibility complex (MHC) class II molecules and other ligands, leading to enhanced T cell activation and proliferation. This, in turn, promotes an anti-tumor immune response and helps to eradicate cancer cells.

Applications of Favezelimab Biosimilar

Favezelimab Biosimilar has shown promising results in preclinical studies for the treatment of different types of cancer, including melanoma, lung cancer, and breast cancer. It has also been evaluated in combination with other immunotherapies, such as anti-PD-1 antibodies, and has demonstrated enhanced anti-tumor activity. The potential of Favezelimab Biosimilar as a cancer therapy has also been supported by its ability to induce immune memory, which can provide long-term protection against cancer recurrence.

Advantages of Favezelimab Biosimilar

Compared to other LAG3-targeting antibodies, Favezelimab Biosimilar has several advantages. Its fully humanized structure reduces the risk of immunogenicity and improves its efficacy in human patients. Additionally, its specificity for LAG3 allows for targeted therapy, minimizing potential off-target effects. Furthermore, Favezelimab Biosimilar has a long half-life, which allows for less frequent dosing and improved patient compliance.

Future Directions

The preclinical data for Favezelimab Biosimilar has been encouraging, and the antibody is now entering clinical trials for the treatment of various cancers. These trials will evaluate the safety, efficacy, and optimal dosing of Favezelimab Biosimilar in different patient populations. If successful, Favezelimab Biosimilar has the potential to become a valuable addition to the current arsenal of cancer immunotherapies.

Conclusion

In summary, Favezelimab Biosimilar is a promising anti-LAG3 monoclonal antibody with the potential to improve cancer treatment. Its unique structure, mechanism of action, and advantageous properties make it a valuable therapeutic candidate for various cancers. As research and clinical trials continue, Favezelimab Biosimilar may become a vital tool in the fight against cancer.

Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade binds to CD223 Recombinant Protein in ELISA assay

Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade binds to CD223 Recombinant Protein in ELISA assay

Immobilized CD223 Recombinant Protein (cat. No.PX-P4110) at 0.5µg/mL (100µL/well) can bind Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade (cat. No.PX-TA1838) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 9.284M.

Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Favezelimab Biosimilar – Anti-LAG3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products