Brand: ProteoGenix

CD223 Recombinant Protein

PX-P4110-100
Validated ELISA

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: P18627
Molecular weight:: 60kDa

Original price was: €475.00.Current price is: €420.00.

100ug 12% OFF + 420 loyalty points

Met1–Leu450 His

Size Size

50ug Original price was: €370.00.Current price is: €294.00.
100ug Original price was: €475.00.Current price is: €420.00.
1MG Original price was: €1,352.00.Current price is: €1,218.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Ieramilimab Biosimilar - Anti-LAG3 mAb binds to CD223 Recombinant Protein in indirect ELISA Assay

Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade binds to CD223 Recombinant Protein in ELISA assay

Datasheet

CD223 Recombinant Protein

Product name	PX-P4110-100
Uniprot ID	P18627
Uniprot link	http://www.uniprot.org/uniprot/P18627
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL
Molecular weight	60kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Leu450
Aliases /Synonyms	LAG3
Reference	PX-P4110
Note	For research use only
Molecular Constructor	Met1–Leu450 His

Product name	PX-P4110-1MG
Uniprot ID	P18627
Uniprot link	http://www.uniprot.org/uniprot/P18627
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL
Molecular weight	60kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Leu450
Aliases /Synonyms	LAG3
Reference	PX-P4110
Note	For research use only
Molecular Constructor	Met1–Leu450 His

Product name	PX-P4110-50
Uniprot ID	P18627
Uniprot link	http://www.uniprot.org/uniprot/P18627
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL
Molecular weight	60kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Leu450
Aliases /Synonyms	LAG3
Reference	PX-P4110
Note	For research use only
Molecular Constructor	Met1–Leu450 His

Datasheet

Ieramilimab Biosimilar - Anti-LAG3 mAb binds to CD223 Recombinant Protein in indirect ELISA Assay

Immobilized CD223 Recombinant Protein (cat. No.PX-P4110) at 0.5µg/mL (100µL/well) can bind to Ieramilimab Biosimilar - Anti-LAG3 mAb (cat. No.PX-TA1562) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade binds to CD223 Recombinant Protein in ELISA assay

Immobilized CD223 Recombinant Protein (cat. No.PX-P4110) at 0.5µg/mL (100µL/well) can bind Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade (cat. No.PX-TA1838) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 9.284M.