Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | CD9 Recombinant Protein |
|---|---|
| Uniprot ID | P21926 |
| Uniprot link | http://www.uniprot.org/uniprot/P21926 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI |
| Molecular weight | 10.5kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS,pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser112~Ile195 |
| Aliases /Synonyms | MIC3, TSPAN29 |
| Reference | PX-P4076 |
| Note | For research use only. |
The cluster of differentiation (CD) system is commonly used as a cell marker for immunophenotyping. Different types of cells in the immune system can be identified by surface CD molecules related to cellular immune function. More than 32 unique CD groups and subcategories have been identified. Some CD molecules act as important receptors or ligands for cells, starting a signal cascade and then altering the cell’s behavior. Some CD proteins are not involved in the cell signaling process, but have other functions, such as cell incorporation. CD9 is a member of the transmembrane superfamily 4, also known as the four transmembrane family. CD9 is a cell surface glycoprotein with 4 hydrophobic domains, which is described as complex with integrins and other transmembrane members of superfamily 4. Found on the surface of exosomes. The protein interferes with cell signal transduction events and, therefore, plays a role in regulating cell development and activation, growth and movement. In addition, CD9 appears to play a key role in egg-sperm fusion during mammalian reproduction. CD9 is found in the oocyte membrane and appears to be able to intervene to maintain the normal shape of oocyte microvilli.
Immobilized CD56 Recombinant Protein (cat. No.PX-P4123) at 0.5µg/mL (100µL/well) can bind to Lorvotuzumab Biosimilar - Anti-NCAM1, CD56 mAb (cat. No.PX-TA1047) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.