Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD66c Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P40199
Molecular weight:
35-48kDa

Original price was: €250.00.Current price is: €223.00.

50ug 11% OFF + 223 loyalty points
Met1–Gly320 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD66c Recombinant Protein

Product name PX-P4088-100
Uniprot ID P40199
Uniprot link http://www.uniprot.org/uniprot/P40199
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
Molecular weight 35-48kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly320
Aliases /Synonyms CD66c,CEACAM6,NCA
Reference PX-P4088
Note For research use only
Molecular Constructor
Met1–Gly320 His
Product name PX-P4088-1MG
Uniprot ID P40199
Uniprot link http://www.uniprot.org/uniprot/P40199
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
Molecular weight 35-48kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly320
Aliases /Synonyms CD66c,CEACAM6,NCA
Reference PX-P4088
Note For research use only
Molecular Constructor
Met1–Gly320 His
Product name PX-P4088-50
Uniprot ID P40199
Uniprot link http://www.uniprot.org/uniprot/P40199
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
Molecular weight 35-48kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly320
Aliases /Synonyms CD66c,CEACAM6,NCA
Reference PX-P4088
Note For research use only
Molecular Constructor
Met1–Gly320 His

General information on CD66c Recombinant Protein:

The cell adhesion molecule associated with carcinoembryonic antigen 6 (non-specific cross-reactive antigen) (CEACAM6) is also known as CD66c (Cluster of Differentiation 66c), CEAL, NCA, and is one of the seven members of the human CEACAM family in the immunoglobulin superfamily. In humans, CEACAM includes type I transmembrane protein (CEACAM1, CEACAM3, and CEACAM4) and GPI-binding molecules (CEACAM5 to CEACAM8). There is no human CEACAM2. CEACAM 6 contains one N-terminal V-type Ig-like domain (N-domain), followed by two C2-like Ig-like domains. It shows considerable glycosylation, including LewisX (sialic acid), which mediates the binding of E-selectin, galectin, and certain bacterial fibers. CEACAM-6 is expressed by granulocytes and their precursors. It is also expressed in the epithelium of various organs and is regulated in adenocarcinomas of the pancreas and colon and hyperplastic polyps. In the case of overexpression of CEACAM6, it is resistant to adhesion-related apoptosis in tumor cells.

SDS-PAGE for CD66c Recombinant Protein

SDS-PAGE for CD66c Recombinant Protein

CD66c Recombinant Protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

CD66c Recombinant Protein

There are no reviews yet.

Be the first to review “CD66c Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products