Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lemalesomab Biosimilar – Anti-NCA-90 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: €196.00.Current price is: €140.00.

50ug 29% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Lemalesomab Biosimilar - Anti-NCA-90 mAb - Research Grade

Product name Lemalesomab Biosimilar - Anti-NCA-90 mAb - Research Grade
Uniprot ID P40199
Source CAS 250242-54-7
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Lemalesomab,78NCA-90, IMMU-MN3,NCA-90 ,anti-NCA-90
Reference PX-TA1200
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Lemalesomab Biosimilar - Anti-NCA-90 mAb - Research Grade
Uniprot ID P40199
Source CAS 250242-54-7
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Lemalesomab,78NCA-90, IMMU-MN3,NCA-90 ,anti-NCA-90
Reference PX-TA1200
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1200-50
Uniprot ID P40199
Source CAS 250242-54-7
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Lemalesomab,78NCA-90, IMMU-MN3,NCA-90 ,anti-NCA-90
Reference PX-TA1200
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

Introduction to Lemalesomab Biosimilar – Anti-NCA-90 mAb

Lemalesomab Biosimilar, also known as Anti-NCA-90 monoclonal antibody (mAb), is a research grade therapeutic antibody that targets the NCA-90 antigen. This biosimilar is a highly specific and potent tool for studying and targeting NCA-90, making it a valuable addition to the scientific community. In this article, we will delve into the structure, activity, and potential applications of Lemalesomab Biosimilar.

Structure of Lemalesomab Biosimilar

Lemalesomab Biosimilar is a monoclonal antibody that is produced using recombinant DNA technology. It is a biosimilar of the original Lemalesomab, which was developed as a therapeutic antibody for treating acute respiratory distress syndrome (ARDS). The biosimilar version has the same amino acid sequence and structure as the original Lemalesomab, making it a highly similar and interchangeable alternative.

The antibody is composed of two identical heavy chains and two identical light chains, which are connected by disulfide bonds. The heavy chains contain a constant region and a variable region, while the light chains only have a variable region. The variable regions of both the heavy and light chains are responsible for binding to the NCA-90 antigen.

Activity of Lemalesomab Biosimilar

Lemalesomab Biosimilar specifically targets the NCA-90 antigen, which is a glycoprotein expressed on the surface of neutrophils, monocytes, and macrophages. This antigen is involved in the adhesion and migration of immune cells, making it a crucial therapeutic target for various inflammatory and autoimmune diseases.

The binding of Lemalesomab Biosimilar to NCA-90 inhibits the adhesion of immune cells to the endothelial cells, thus reducing inflammation and tissue damage. It also promotes the phagocytosis of immune cells, leading to the clearance of pathogens and damaged cells. These activities make Lemalesomab Biosimilar a potent anti-inflammatory and immunomodulatory agent.

Applications of Lemalesomab Biosimilar

Lemalesomab Biosimilar has a wide range of potential applications in both research and therapeutic settings. Its specific targeting of the NCA-90 antigen makes it a valuable tool for studying the role of this antigen in various diseases. It can also be used to develop diagnostic assays for detecting NCA-90 expression levels in different cell types.

In terms of therapeutic applications, Lemalesomab Biosimilar has the potential to treat various inflammatory and autoimmune diseases, such as ARDS, rheumatoid arthritis, and inflammatory bowel disease. Its ability to modulate the immune response and reduce inflammation makes it a promising candidate for these conditions.

Moreover, Lemalesomab Biosimilar can also be used in combination with other therapeutic agents to enhance their efficacy. For example, it can be used in combination with chemotherapy drugs to increase the phagocytic activity of immune cells, leading to better clearance of cancer cells.

Conclusion

In summary, Lemalesomab Biosimilar is a highly specific and potent therapeutic antibody that targets the NCA-90 antigen. Its structure, activity, and potential applications make it a valuable tool for scientific research and a promising candidate for the treatment of various inflammatory and autoimmune diseases. With its interchangeable biosimilar version, Lemalesomab Biosimilar offers an affordable and accessible option for researchers and clinicians alike.

SDS-PAGE for Lemalesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade

SDS-PAGE for Lemalesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade

Lemalesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Lemalesomab Biosimilar - Anti-NCA-90  mAb - Research Grade

There are no reviews yet.

Be the first to review “Lemalesomab Biosimilar – Anti-NCA-90 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products