Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

CD337 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
O14931
Molecular weight:
20-25kDa

€420.00

100ug + 420 loyalty points
Met1–Leu134 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
CD337 Recombinant Protein

CD337 Recombinant Protein

Product name CD337 Recombinant Protein
Uniprot ID O14931
Uniprot link http://www.uniprot.org/uniprot/O14931
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQL
Molecular weight 20-25kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Leu134
Aliases /Synonyms 1C7,CD337,DAAP-90L16.3,LY117,MALS,NCR3,NKp30
Reference PX-P4120
Note For research use only
Background information Array
Molecular Constructor
Met1–Leu134 His

General information on CD337 Recombinant Protein:

The recombinant human CD337 / NKp30 / NCR3 protein is produced by a human cell expression system.
The protein is a natural cytotoxicity receptor (NCR), which helps NK cells to lyse tumor cells. The encoded protein interacts with the CD3-zeta T-cell receptor (CD247). The single nucleotide polymorphism in the 5 ‘untranslated region of the gene is associated with slight poverty. Three transcriptional variants of this gene encoding different isoforms have been found.

There are no reviews yet.

Be the first to review “CD337 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products