Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

c-JUN Protein – Transcription factor AP-1(JUN)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P05412
Molecular weight:
37.78kDa

Original price was: €229.00.Current price is: €182.00.

50ug 21% OFF + 182 loyalty points
Met1–Phe331
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

c-JUN Protein - Transcription factor AP-1(JUN)

Product name c-JUN Protein - Transcription factor AP-1(JUN)
Uniprot ID P05412
Uniprot link https://www.uniprot.org/uniprot/P05412
Expression system Prokaryotic expression
Raw Antigen Sequence MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Molecular weight 37.78kDa
Purity estimated >90% by SDS-PAGE
Buffer 0.02% Sarcosyl, PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe331
Aliases /Synonyms Activator protein 1,Proto-oncogene c-Jun,V-jun avian sarcoma virus 17 oncogene homolog,p39
Reference PX-P4739
Note For research use only
Molecular Constructor
Met1–Phe331
Product name c-JUN Protein - Transcription factor AP-1(JUN)
Uniprot ID P05412
Uniprot link https://www.uniprot.org/uniprot/P05412
Expression system Prokaryotic expression
Raw Antigen Sequence MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Molecular weight 37.78kDa
Purity estimated >90% by SDS-PAGE
Buffer 0.02% Sarcosyl, PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe331
Aliases /Synonyms Activator protein 1,Proto-oncogene c-Jun,V-jun avian sarcoma virus 17 oncogene homolog,p39
Reference PX-P4739
Note For research use only
Molecular Constructor
Met1–Phe331
Product name PX-P4739-1MG
Uniprot ID P05412
Uniprot link https://www.uniprot.org/uniprot/P05412
Expression system Prokaryotic expression
Raw Antigen Sequence MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Molecular weight 37.78kDa
Purity estimated >90% by SDS-PAGE
Buffer 0.02% Sarcosyl, PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe331
Aliases /Synonyms Activator protein 1,Proto-oncogene c-Jun,V-jun avian sarcoma virus 17 oncogene homolog,p39
Reference PX-P4739
Note For research use only
Molecular Constructor
Met1–Phe331

More Information about c-JUN Protein

C-Jun protein is coded by the JUN gene in humans. This protein, together with c-Fos protein forms the AP-1 transcription factor. Because of its interaction with c-Fos protein, c-Jun protein was initially identified as a Fos-binding protein p39. C-Jun protein is involved in the progression through G1 phase. The role of c-Jun protein is to regulate the activity of cyclin D1 activity which is a Rb kinase. Rb protein is a growth suppressor and is inactivated upon phosphorylation. When c-jun protein is absent, the expression of both p53 and p21 increases which results in cell cycle defects. For this reason, c-jun knockout is lethal. However, transgenic animals that contain c-jun protein that cannot undergo phosphorylation, can survive. In this case cells remain blocked in G1 phase. Upregulation of c-jun protein results in increased cell growth and proliferation which makes c-jun a proto-oncogenic protein.

C-Jun, along with c-Fos protein are highly regulated by different extracellular stimuli such as growth factors, pro-inflammatory cytokines, UV irradiation and oxidative cellular stress. Indeed, increased UV irradiation has been linked to elevated c-jun expression. ERK pathway has also been involved in c-jun expression regulation. Active ERK increases c-jun transcription as well as its stability. The mobilization of c-jun protein leads to the activation of it downstream target RCAK1 which enhances JNK activity. JNK is a kinase that binds to c-jun and double phosphorylates the protein on Ser-63 and Ser-73 of its transcriptional activation domain. Research suggests that the phosphorylation of c-jun protein on threonine 91 and 93 triggers c-jun pro-apoptotic activity . According to Ce et al., (2013) the phosphorylation of c-Jun at threonine 91 and threonine 93 is dependent of threonine 95 which suggested the combination of the three threonines as a sensitive amplifier of the JNK cascade. On the other hand, the JNK triggered survival pathway is inhibited by a survival pathway initiate by lithium which represses pro-apoptotic c-Jun/Ap-1 target genes.

c-JUN Protein - Transcription factor AP-1(JUN)

There are no reviews yet.

Be the first to review “c-JUN Protein – Transcription factor AP-1(JUN)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products