Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Brentuximab Biosimilar – Anti-TNFRSF8 mAb – Research Grade

  • PX-TA1621-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1

Original price was: €176.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade

Product name Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade
Uniprot ID P28908
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Purity >85%
Buffer PBS buffer pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Brentuximab,0,TNFRSF8,anti-TNFRSF8
Reference PX-TA1621
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Human IgG1
Clonality Monoclonal Antibody
Product name Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade
Uniprot ID P28908
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Purity >85%
Buffer PBS buffer pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Brentuximab,0,TNFRSF8,anti-TNFRSF8
Reference PX-TA1621
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Human IgG1
Clonality Monoclonal Antibody
Product name PX-TA1621-50
Uniprot ID P28908
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Purity >85%
Buffer PBS buffer pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Brentuximab,0,TNFRSF8,anti-TNFRSF8
Reference PX-TA1621
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody

Brentuximab Biosimilar – Anti-TNFRSF8 mAb – Research Grade Brentuximab Biosimilar – Anti-TNFRSF8 mAb – Research Grade Introduction

Brentuximab Biosimilar is a monoclonal antibody (mAb) that targets TNFRSF8, also known as CD30. It is a biosimilar version of the therapeutic antibody brentuximab vedotin, which is used in the treatment of various types of cancer. In this article, we will provide a scientific description of the structure, activity, and application of Brentuximab Biosimilar.

Structure of Brentuximab Biosimilar

Brentuximab Biosimilar is a chimeric antibody, meaning it is composed of both human and non-human components. It is made up of a human IgG1 constant region and a mouse-derived variable region that specifically binds to TNFRSF8. The antibody has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains.

Activity of Brentuximab Biosimilar

Brentuximab Biosimilar works by binding to TNFRSF8, a protein that is overexpressed on the surface of certain cancer cells. This binding leads to the activation of immune cells, such as natural killer cells and T cells, which then target and kill the cancer cells. In addition, the antibody also induces cell death through a process known as antibody-dependent cellular cytotoxicity (ADCC), where immune cells are recruited to kill the cancer cells.

Application of Brentuximab Biosimilar

Brentuximab Biosimilar has been approved for the treatment of Hodgkin lymphoma and systemic anaplastic large cell lymphoma (sALCL). It is typically used in combination with chemotherapy or as a standalone treatment for patients who have relapsed or are refractory to other therapies. In addition, Brentuximab Biosimilar is also being studied for its potential in treating other types of cancer, such as non-Hodgkin lymphoma and solid tumors.

Conclusion

Brentuximab Biosimilar is a chimeric monoclonal antibody that targets TNFRSF8 and is used in the treatment of certain types of cancer. Its structure, activity, and application make it a promising therapeutic option for patients with relapsed or refractory cancer. Further research is being conducted to explore its potential in treating other types of cancer and to improve its efficacy and safety profile.

Keywords

antibody, therapeutic target, Brentuximab Biosimilar, Anti-TNFRSF8 mAb, research grade, structure, activity, application, cancer, Hodgkin lymphoma, systemic anaplastic large cell lymphoma, non-Hodgkin lymphoma, solid tumors.

SDS-PAGE for Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade

SDS-PAGE for Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade

Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Flow Cytometry results for Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade

Flow Cytometry results for Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Brentuximab Biosimilar - Anti-TNFRSF8 mAb - Research Grade

There are no reviews yet.

Be the first to review “Brentuximab Biosimilar – Anti-TNFRSF8 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products