Trichinella spiralis Adzh68 Recombinant Protein

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameTrichinella spiralis Adzh68 Recombinant Protein
Uniprot IDB0F9T9
Uniprot linkhttp://www.uniprot.org/uniprot/B0F9T9
Origin speciesTrichinella spiralis
Expression systemProcaryotic expression
SequenceMAHNHRHKHKLISGGSVATPNSIPYQARLVFRKAGNRIKLCGGSLVELKPGNGSQWVLTAAHCAYYAEYGRRFTPDEVQV ILGAHRPNEEERTQLKVDTKRIISHPRYDDVTVVYDLSLVMLKEYVIYNNEIRSACLPKPDEPVPLDVPCFASGWGITYQ GGRGSDVLRIAEMKPLPKDECRIKPEEHAIVFCAYGVDRSATCQGDSGGPVVCLKNNKATLYGIVSYGPPTCGDARHSVK FAKVPAMMQWIQDTARSIDSTVPVVSRFEPKPSEQKVDQKDTQPSPSVSPGRVDVGKKDIMKDLPEIPTRENVKDTPGDY KGSDVFNFIYRDGFPSHSKFPDLEQIMSDFMSPGSGGMSGGSFFNSPRVFIETKTINRLPSVSRSRSDVGRFGFNDPSFT FFR
Molecular weight44,70 kDa
Protein delivered with Tag?Yes
Purity estimated80% native, >95% denatured
BufferPBS, imidazole 250mM in native conditions. PBS, Urea 4M in denaturing conditions
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionABY60762.1
Spec:SwissProtIDB0F9T9
NCBI ReferenceABY60762.1
Aliases /SynonymsAdzh68-∆Nter, putative serine protease
ReferencePX-P1067
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Trichinella spiralis Adzh68 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.