Tobacco TEV Protease Recombinant Enzyme

Reference:
Size

1000U, 100U, 500U

Brand

Product type

Host Species

Applications

,

Product nameTobacco TEV Protease Recombinant Enzyme
Origin speciesTobacco
Expression systemProkaryotic expression
SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSGESLFKGPR DYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFKVKDTTTLQQHLIDGRDMMIIRMPK DFPPFPQKLKFREPQREERICLVTTNFQAKSMSSMVSDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSA SNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNELVYSQ
Molecular weight54,23 kDa
Protein delivered with Tag?N-terminal GST Tag
Buffer50 mM,pH8.0, 0.5 mM EDTA,DTT 1mM
FormFrozen
Delivery conditionDry Ice
Delivery lead time in business days5-7
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
ApplicationsELISA,WB
Fragment TypeProperty sequence
Protein AccessionNP_734212.1
NCBI ReferenceNP_734212.1
Aliases /SynonymsGST-TEV, NIa-Pro protein (TEV protease)
ReferencePX-P1108
NoteFor research use only

Description of Tobacco TEV Protease Recombinant Enzyme

General information on Tobacco TEV Protease Recombinant Enzyme:

TEV (Tobacco Etch Virus) Protease is a highly site-specific cysteine protease that is found in the Tobacco Etch Virus. Due to its high sequence specificity it is regularly used to cleave affinity tags from fusion proteins. The TEV encodes its whole genome as a single massive polyprotein. This is cleaved into functional units by the three proteases: P1 protease (1 cleavage site), helper-component protease (1 cleavage site) and TEV protease (7 cleavage sites). The greatest recognition site for this enzyme is the sequence Glu-Asn-Leu-Tyr-Phe-Gln-(Gly/Ser) [ENLYFQ/S] and cleavage appear between the Gln and Gly/Ser residues.

Publication

  • 1: Martínez F, Daròs JA. Tobacco etch virus protein P1 traffics to the nucleolus and associates with the host 60S ribosomal subunits during infection. J Virol. 2014 Sep;88(18):10725-37. doi: 10.1128/JVI.00928-14. Epub 2014 Jul 2. PubMed PMID: 24991017; PubMed Central PMCID: PMC4178839.
  • 2: Cui X, Wei T, Chowda-Reddy RV, Sun G, Wang A. The Tobacco etch virus P3 protein forms mobile inclusions via the early secretory pathway and traffics along actin microfilaments. Virology. 2010 Feb 5;397(1):56-63. doi: 10.1016/j.virol.2009.11.015. Epub 2009 Nov 30. PubMed PMID: 19945728.
  • 3: Torres-Barceló C, Martín S, Daròs JA, Elena SF. From hypo- to hypersuppression: effect of amino acid substitutions on the RNA-silencing suppressor activity of the Tobacco etch potyvirus HC-Pro. Genetics. 2008 Oct;180(2):1039-49. doi: 10.1534/genetics.108.091363. Epub 2008 Sep 9. PubMed PMID: 18780745; PubMed Central PMCID: PMC2567354.
  • 4: Allison RF, Dougherty WG, Parks TD, Willis L, Johnston RE, Kelly M, Armstrong FB. Biochemical analysis of the capsid protein gene and capsid protein of tobacco etch virus: N-terminal amino acids are located on the virion's surface. Virology. 1985 Dec;147(2):309-16. PubMed PMID: 18640560.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Tobacco TEV Protease Recombinant Enzyme”

Your email address will not be published. Required fields are marked *

Related products

Anti GST tag mouse monoclonal antibody
Tag Antibody

Anti GST tag mouse monoclonal antibody

PTX17859 180€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.






    Cart (0 Items)

    Your cart is currently empty.

    View Products