Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

TGFB2 recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P61812
Molecular weight:
12.32 kDa

Original price was: €276.00.Current price is: €230.00.

50ug 17% OFF + 230 loyalty points
Ala303–Ser414
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

TGFB2 recombinant protein

Product name PX-P5188-100
Uniprot ID P61812
Uniprot link https://www.uniprot.org/uniprot/P61812
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Molecular weight 12.32 kDa
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala303-Ser414
Protein Accession P61812
Aliases /Synonyms TGF-beta-2, Transforming Growth Factor proteins beta-2 proprotein
Reference PX-P5188
Note For research use only
Molecular Constructor
Ala303–Ser414
Product name PX-P5188-1MG
Uniprot ID P61812
Uniprot link https://www.uniprot.org/uniprot/P61812
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Molecular weight 12.32 kDa
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala303-Ser414
Protein Accession P61812
Aliases /Synonyms TGF-beta-2, Transforming Growth Factor proteins beta-2 proprotein
Reference PX-P5188
Note For research use only
Molecular Constructor
Ala303–Ser414
Product name PX-P5188-50
Uniprot ID P61812
Uniprot link https://www.uniprot.org/uniprot/P61812
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Molecular weight 12.32 kDa
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala303-Ser414
Protein Accession P61812
Aliases /Synonyms TGF-beta-2, Transforming Growth Factor proteins beta-2 proprotein
Reference PX-P5188
Note For research use only
Molecular Constructor
Ala303–Ser414

TGFB2 recombinant protein

There are no reviews yet.

Be the first to review “TGFB2 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products