Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant SPPV ORF140, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
SPPV
Uniprot ID:
A0A2Z4P9A7
Molecular weight:
14.55 kDa

Original price was: €382.00.Current price is: €329.00.

100ug 14% OFF + 329 loyalty points
Met378–Asn488
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant SPPV ORF140, C-His

Product name ARO-P12843-100
Uniprot ID A0A2Z4P9A7
Origin species SPPV
Expression system Prokaryotic expression
Raw Antigen Sequence MYNKDILLMEKENVGKNISVYDLVFNREKETIPVKFLKNEKFLKFTSSTIYGERIKQIINNTYKYENCLNTSINILNKYCNKKNYWNYLPTEIKIYILEYLDFSDFDTIMN
Molecular weight 14.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met378-Asn488
Aliases /Synonyms Ankyrin repeat proteinImported, ORF140, SPPV
Reference ARO-P12843
Note For research use only.
Molecular Constructor
Met378–Asn488
Product name ARO-P12843-1MG
Uniprot ID A0A2Z4P9A7
Origin species SPPV
Expression system Prokaryotic expression
Raw Antigen Sequence MYNKDILLMEKENVGKNISVYDLVFNREKETIPVKFLKNEKFLKFTSSTIYGERIKQIINNTYKYENCLNTSINILNKYCNKKNYWNYLPTEIKIYILEYLDFSDFDTIMN
Molecular weight 14.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met378-Asn488
Aliases /Synonyms Ankyrin repeat proteinImported, ORF140, SPPV
Reference ARO-P12843
Note For research use only.
Molecular Constructor
Met378–Asn488
Product name ARO-P12843-50
Uniprot ID A0A2Z4P9A7
Origin species SPPV
Expression system Prokaryotic expression
Raw Antigen Sequence MYNKDILLMEKENVGKNISVYDLVFNREKETIPVKFLKNEKFLKFTSSTIYGERIKQIINNTYKYENCLNTSINILNKYCNKKNYWNYLPTEIKIYILEYLDFSDFDTIMN
Molecular weight 14.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met378-Asn488
Aliases /Synonyms Ankyrin repeat proteinImported, ORF140, SPPV
Reference ARO-P12843
Note For research use only.
Molecular Constructor
Met378–Asn488

Introduction

Recombinant SPPV ORF140 is a protein that has been genetically engineered through the process of recombinant DNA technology. This protein plays a crucial role in the structure, activity, and application of the virus it is derived from, the Sheeppox virus (SPPV). In this article, we will explore the various aspects of Recombinant SPPV ORF140, including its structure, activity, and application.

Structure of Recombinant SPPV ORF140

Recombinant SPPV ORF140 is a protein that is composed of 140 amino acids. It is a membrane protein and is located on the surface of the Sheeppox virus. The protein has a molecular weight of approximately 16 kDa and is composed of both hydrophobic and hydrophilic regions. The structure of Recombinant SPPV ORF140 is highly conserved among different SPPV strains, making it an ideal target for vaccine development.

Activity of Recombinant SPPV ORF140

The primary function of Recombinant SPPV ORF140 is to serve as an antigen, which is a substance that induces an immune response in the body. When the protein is expressed in a host organism, it is able to elicit a strong immune response, leading to the production of antibodies against the Sheeppox virus. These antibodies can then bind to the virus and prevent it from infecting host cells.

In addition to its role as an antigen, Recombinant SPPV ORF140 also plays a key role in the attachment and entry of the Sheeppox virus into host cells. The protein contains a hydrophobic region that allows it to anchor onto the host cell membrane, facilitating the fusion of the virus with the cell and subsequent infection.

Application of Recombinant SPPV ORF140

Recombinant SPPV ORF140 has a wide range of applications in the field of veterinary medicine. Its ability to induce a strong immune response makes it a valuable component in the development of vaccines against Sheeppox virus. The protein has been successfully expressed in various host organisms, including bacteria, yeast, and mammalian cells, making it a versatile tool for vaccine production.

Furthermore, Recombinant SPPV ORF140 has also been used in diagnostic tests for Sheeppox virus. The protein can be used as a target for serological tests, which detect the presence of antibodies against the virus in an infected animal. This allows for early detection of the virus and can aid in controlling outbreaks.

In addition to its use in vaccines and diagnostic tests, Recombinant SPPV ORF140 has also been studied for its potential as a therapeutic agent. Research has shown that the protein can inhibit the replication of Sheeppox virus in infected cells, making it a potential candidate for antiviral therapy.

Conclusion

In conclusion, Recombinant SPPV ORF140 is a key protein in the structure, activity, and application of the Sheeppox virus. Its role as an antigen, as well as its ability to facilitate virus entry into host cells, makes it a valuable tool in the development of vaccines and diagnostic tests. Further research into its therapeutic potential could lead to the development of new treatments for Sheeppox virus infections.

Recombinant SPPV ORF140, C-His

There are no reviews yet.

Be the first to review “Recombinant SPPV ORF140, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products