Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse WNT8A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q64527
Molecular weight:
26.60 kDa

Original price was: €237.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Thr31–Ala247
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse WNT8A Protein, N-His

Product name ARO-P10521-100
Uniprot ID Q64527
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TRPKAYLTYTASVALGAQIGIEECKFQFAWERWNCPEHAFQFSTHNRLRAATRETSFIHAIRSAAIMYAVTKNCSMGDLENCGCDESQNGKTGGHGWIWGGCSDNVEFGEKISRLFVDSLEKGKDARALVNLHNNRAGRLAVRASTKRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIEMDKRQLRAGNRAEGRWALTEAFLPSTEA
Molecular weight 26.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr31-Ala247
Aliases /Synonyms WNT8D, Protein Wnt-8d, WNT8A, Protein Wnt-8a
Reference ARO-P10521
Note For research use only.
Molecular Constructor
Thr31–Ala247
Product name ARO-P10521-1MG
Uniprot ID Q64527
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TRPKAYLTYTASVALGAQIGIEECKFQFAWERWNCPEHAFQFSTHNRLRAATRETSFIHAIRSAAIMYAVTKNCSMGDLENCGCDESQNGKTGGHGWIWGGCSDNVEFGEKISRLFVDSLEKGKDARALVNLHNNRAGRLAVRASTKRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIEMDKRQLRAGNRAEGRWALTEAFLPSTEA
Molecular weight 26.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr31-Ala247
Aliases /Synonyms WNT8D, Protein Wnt-8d, WNT8A, Protein Wnt-8a
Reference ARO-P10521
Note For research use only.
Molecular Constructor
Thr31–Ala247
Product name ARO-P10521-50
Uniprot ID Q64527
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TRPKAYLTYTASVALGAQIGIEECKFQFAWERWNCPEHAFQFSTHNRLRAATRETSFIHAIRSAAIMYAVTKNCSMGDLENCGCDESQNGKTGGHGWIWGGCSDNVEFGEKISRLFVDSLEKGKDARALVNLHNNRAGRLAVRASTKRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIEMDKRQLRAGNRAEGRWALTEAFLPSTEA
Molecular weight 26.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr31-Ala247
Aliases /Synonyms WNT8D, Protein Wnt-8d, WNT8A, Protein Wnt-8a
Reference ARO-P10521
Note For research use only.
Molecular Constructor
Thr31–Ala247

Introduction

Recombinant Mouse WNT8A Protein is a highly purified and biologically active protein that plays a crucial role in various cellular processes. It belongs to the Wnt family of secreted signaling proteins, which are known to regulate important developmental and homeostatic processes in both embryonic and adult tissues. In this article, we will discuss the structure, activity and applications of this recombinant protein.

Structure of Recombinant Mouse WNT8A Protein

The recombinant mouse WNT8A protein is produced by cloning and expressing the WNT8A gene in a suitable host cell, such as E. coli or mammalian cells. The resulting protein is a glycosylated homodimer, with a molecular weight of approximately 39 kDa. It contains 346 amino acids and has a conserved cysteine-rich domain, which is essential for its biological activity.

Activity of Recombinant Mouse WNT8A Protein

Recombinant Mouse WNT8A Protein is a potent activator of the canonical Wnt signaling pathway. Upon binding to its receptor, Frizzled, it induces the stabilization and nuclear translocation of β-catenin, a key mediator of Wnt signaling. This leads to the activation of downstream target genes, which are involved in cell proliferation, differentiation, and migration. WNT8A has also been shown to play a role in the regulation of stem cell self-renewal and tissue regeneration.

Applications of Recombinant Mouse WNT8A Protein

Due to its crucial role in Wnt signaling, recombinant mouse WNT8A protein has a wide range of applications in both basic research and pharmaceutical development.

Studying Developmental Processes

Wnt signaling is essential for embryonic development, and WNT8A is known to be involved in the development of various tissues and organs, including the brain, spinal cord, and limbs. Recombinant mouse WNT8A protein can be used to study the role of WNT8A in these processes, either by adding it to cell cultures or by injecting it into developing embryos. This can provide valuable insights into the mechanisms of tissue formation and organogenesis.

Stem Cell Research

Wnt signaling is also crucial for the maintenance and differentiation of stem cells. Recombinant mouse WNT8A protein can be used to induce the differentiation of pluripotent stem cells into specific cell types, such as neurons or muscle cells. It can also be used to expand the population of stem cells in culture, making it a valuable tool for stem cell research and regenerative medicine.

Drug Discovery

Aberrant Wnt signaling has been linked to various diseases, including cancer, neurodegenerative disorders, and cardiovascular diseases. Recombinant mouse WNT8A protein can be used to screen for potential drugs that modulate Wnt signaling, either by promoting or inhibiting its activity. This can aid in the development of novel therapies for Wnt-related diseases.

Antigen for Antibody Production

Recombinant mouse WNT8A protein can also be used as an antigen to produce antibodies that specifically recognize WNT8A. These antibodies can be used for various applications, such as immunohistochemistry, Western blotting, and flow cytometry, to study the expression and localization of WNT8A in different tissues and cell types.

Diagnostic Tool

Aberrant Wnt signaling has been implicated in various diseases, and the levels of WNT8A expression have been shown to be altered in certain cancers and other disorders. Recombinant mouse WNT8A protein can be used as a diagnostic tool to detect and monitor these diseases, either by measuring its levels in patient samples or by using it as a target for imaging techniques.</

Recombinant Mouse WNT8A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse WNT8A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products