Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD267/TNFRSF13B Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9ET35
Molecular weight:
11.30 kDa

Original price was: €297.00.Current price is: €230.00.

50ug 23% OFF + 230 loyalty points
Met1–Arg79
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD267/TNFRSF13B Protein, N-His

Product name ARO-P10464-100
Uniprot ID Q9ET35
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MAMAFCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKR
Molecular weight 11.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg79
Aliases /Synonyms CD267, Transmembrane activator and CAML interactor, Tumor necrosis factor receptor superfamily member 13B, TNFRSF13B, TACI
Reference ARO-P10464
Note For research use only.
Molecular Constructor
Met1–Arg79
Product name ARO-P10464-1MG
Uniprot ID Q9ET35
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MAMAFCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKR
Molecular weight 11.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg79
Aliases /Synonyms CD267, Transmembrane activator and CAML interactor, Tumor necrosis factor receptor superfamily member 13B, TNFRSF13B, TACI
Reference ARO-P10464
Note For research use only.
Molecular Constructor
Met1–Arg79
Product name ARO-P10464-50
Uniprot ID Q9ET35
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MAMAFCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKR
Molecular weight 11.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg79
Aliases /Synonyms CD267, Transmembrane activator and CAML interactor, Tumor necrosis factor receptor superfamily member 13B, TNFRSF13B, TACI
Reference ARO-P10464
Note For research use only.
Molecular Constructor
Met1–Arg79

Recombinant Mouse CD267/TNFRSF13B Protein, also known as B-cell maturation antigen (BCMA), is a type III transmembrane protein that belongs to the tumor necrosis factor receptor superfamily. It is primarily expressed on the surface of B cells and plays a crucial role in regulating B cell survival and differentiation. Recombinant Mouse CD267/TNFRSF13B Protein is a valuable tool for research in immunology and cancer biology, and has potential therapeutic applications in various diseases.

Structure of Recombinant Mouse CD267/TNFRSF13B Protein

Recombinant Mouse CD267/TNFRSF13B Protein is a 184 amino acid protein with a predicted molecular weight of approximately 21 kDa. It consists of a signal peptide, a cysteine-rich domain, four extracellular cysteine-rich repeats, a transmembrane domain, and a cytoplasmic tail. The extracellular domain of Recombinant Mouse CD267/TNFRSF13B Protein contains the binding site for its ligand, B-cell activating factor (BAFF), and its homolog, a proliferation-inducing ligand (APRIL).

The crystal structure of Recombinant Mouse CD267/TNFRSF13B Protein has been determined, revealing a trimeric assembly of the extracellular domain. The trimeric structure is essential for ligand binding and signal transduction. The cytoplasmic tail of Recombinant Mouse CD267/TNFRSF13B Protein contains a conserved death domain, which is crucial for activating downstream signaling pathways.

Activity of Recombinant Mouse CD267/TNFRSF13B Protein

Recombinant Mouse CD267/TNFRSF13B Protein is a key regulator of B cell function and survival. Its main function is to bind to BAFF and APRIL, which are essential factors for B cell development and maturation. By binding to these ligands, Recombinant Mouse CD267/TNFRSF13B Protein activates signaling pathways that promote B cell survival and proliferation. It also plays a role in regulating the production of antibodies by B cells.

In addition to its role in B cell biology, Recombinant Mouse CD267/TNFRSF13B Protein has been implicated in the pathogenesis of various diseases. It has been shown to be overexpressed in multiple myeloma, a type of blood cancer, and may contribute to the survival and growth of cancer cells. Recombinant Mouse CD267/TNFRSF13B Protein has also been linked to autoimmune diseases, such as systemic lupus erythematosus and rheumatoid arthritis, as well as inflammatory conditions like multiple sclerosis and inflammatory bowel disease.

Application of Recombinant Mouse CD267/TNFRSF13B Protein

Recombinant Mouse CD267/TNFRSF13B Protein has a wide range of applications in both research and therapeutic settings. In research, it is commonly used as a tool to study B cell biology, including B cell survival, proliferation, and antibody production. It is also used to investigate the role of Recombinant Mouse CD267/TNFRSF13B Protein in diseases such as cancer and autoimmune disorders.

In the field of therapeutics, Recombinant Mouse CD267/TNFRSF13B Protein has shown promise as a potential target for the treatment of various diseases. Several monoclonal antibodies targeting Recombinant Mouse CD267/TNFRSF13B Protein have been developed and are currently being evaluated in clinical trials for the treatment of multiple myeloma and other B cell malignancies. In addition, Recombinant Mouse CD267/TNFRSF13B Protein has been identified as a potential target for the treatment of autoimmune diseases, and drugs targeting this protein are currently in development.

In conclusion, Recombinant Mouse CD267/TNFRSF13B Protein

Recombinant Mouse CD267/TNFRSF13B Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD267/TNFRSF13B Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products