Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TWIST2 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8WVJ9
Molecular weight:
25.36 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Ser60–His160
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TWIST2 Protein, N-His-SUMO & C-Strep

Product name ARO-P11866-100
Uniprot ID Q8WVJ9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH
Molecular weight 25.36 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser60-His160
Aliases /Synonyms Class A basic helix-loop-helix protein 39, Twist-related protein 2, DERMO1, Dermo-1, BHLHA39, TWIST2, bHLHa39, Dermis-expressed protein 1
Reference ARO-P11866
Note For research use only.
Molecular Constructor
Ser60–His160
Product name ARO-P11866-1MG
Uniprot ID Q8WVJ9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH
Molecular weight 25.36 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser60-His160
Aliases /Synonyms Class A basic helix-loop-helix protein 39, Twist-related protein 2, DERMO1, Dermo-1, BHLHA39, TWIST2, bHLHa39, Dermis-expressed protein 1
Reference ARO-P11866
Note For research use only.
Molecular Constructor
Ser60–His160
Product name ARO-P11866-50
Uniprot ID Q8WVJ9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH
Molecular weight 25.36 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser60-His160
Aliases /Synonyms Class A basic helix-loop-helix protein 39, Twist-related protein 2, DERMO1, Dermo-1, BHLHA39, TWIST2, bHLHa39, Dermis-expressed protein 1
Reference ARO-P11866
Note For research use only.
Molecular Constructor
Ser60–His160

Structure of Recombinant Human TWIST2 Protein

Recombinant human TWIST2 protein, also known as Twist-related protein 2, is a member of the basic helix-loop-helix (bHLH) family of transcription factors. It is encoded by the TWIST2 gene located on chromosome 2 in humans. The protein consists of 202 amino acids and has a molecular weight of approximately 22 kDa.

The structure of TWIST2 protein consists of two distinct domains: the basic region and the helix-loop-helix (HLH) region. The basic region contains a DNA binding motif, while the HLH region is responsible for protein-protein interactions. These domains play a crucial role in the function of TWIST2 protein as a transcription factor.

Activity of Recombinant Human TWIST2 Protein

TWIST2 protein is involved in various cellular processes, including embryonic development, cell differentiation, and cell migration. It has been shown to regulate the expression of genes involved in epithelial-mesenchymal transition (EMT), a process that plays a critical role in tumor metastasis. TWIST2 is also involved in the regulation of cell proliferation and apoptosis, making it a key player in cancer development and progression.

As a transcription factor, TWIST2 binds to specific DNA sequences, known as E-boxes, and regulates the expression of target genes. It can act as both a transcriptional activator and a repressor, depending on the cellular context and the presence of other co-regulators. TWIST2 is known to interact with other transcription factors, such as Snail, Slug, and ZEB1, to regulate gene expression and control cellular processes.

Application of Recombinant Human TWIST2 Protein

The recombinant human TWIST2 protein has been widely used in various research studies to understand its role in cancer and other diseases. It is commonly expressed in E. coli or mammalian cells and purified to high levels for in vitro experiments. The protein has also been used to generate specific antibodies for detection and quantification of TWIST2 in various tissues and cell lines.

One of the major applications of recombinant human TWIST2 protein is in cancer research. Studies have shown that TWIST2 is overexpressed in several types of cancer, including breast, lung, and colon cancer. It has been linked to tumor growth, invasion, and metastasis, making it a potential therapeutic target for cancer treatment. Recombinant TWIST2 protein has been used in cell-based assays to investigate its role in cancer development and to screen for potential inhibitors that can block its activity.

In addition to cancer, TWIST2 has also been implicated in other diseases, such as cardiovascular disorders, fibrosis, and neurodegenerative diseases. The recombinant protein has been used to study its role in these conditions and to identify potential therapeutic strategies.

Conclusion

In summary, recombinant human TWIST2 protein is a crucial transcription factor involved in various cellular processes, including cancer development and progression. Its structure, activity, and application have been extensively studied, and it continues to be a subject of interest in the scientific community. With further research, TWIST2 protein may hold the key to understanding and treating various diseases.

Recombinant Human TWIST2 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human TWIST2 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products