Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TTC7A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9ULT0
Molecular weight:
17.65 kDa

Original price was: €220.00.Current price is: €193.00.

50ug 12% OFF + 193 loyalty points
Arg675–Thr811
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TTC7A Protein, N-His

Product name ARO-P11883-100
Uniprot ID Q9ULT0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RRASSIAASRLEEAMSELTMPSSVLKQGPMQLWTTLEQIWLQAAELFMEQQHLKEAGFCIQEAAGLFPTSHSVLYMRGRLAEVKGNLEEAKQLYKEALTVNPDGVRIMHSLGLMLSRLGHKSLAQKVLRDAVERQST
Molecular weight 17.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg675-Thr811
Aliases /Synonyms TPR repeat protein 7A, TTC7A, TTC7, KIAA1140, Tetratricopeptide repeat protein 7A
Reference ARO-P11883
Note For research use only.
Molecular Constructor
Arg675–Thr811
Product name ARO-P11883-1MG
Uniprot ID Q9ULT0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RRASSIAASRLEEAMSELTMPSSVLKQGPMQLWTTLEQIWLQAAELFMEQQHLKEAGFCIQEAAGLFPTSHSVLYMRGRLAEVKGNLEEAKQLYKEALTVNPDGVRIMHSLGLMLSRLGHKSLAQKVLRDAVERQST
Molecular weight 17.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg675-Thr811
Aliases /Synonyms TPR repeat protein 7A, TTC7A, TTC7, KIAA1140, Tetratricopeptide repeat protein 7A
Reference ARO-P11883
Note For research use only.
Molecular Constructor
Arg675–Thr811
Product name ARO-P11883-50
Uniprot ID Q9ULT0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RRASSIAASRLEEAMSELTMPSSVLKQGPMQLWTTLEQIWLQAAELFMEQQHLKEAGFCIQEAAGLFPTSHSVLYMRGRLAEVKGNLEEAKQLYKEALTVNPDGVRIMHSLGLMLSRLGHKSLAQKVLRDAVERQST
Molecular weight 17.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg675-Thr811
Aliases /Synonyms TPR repeat protein 7A, TTC7A, TTC7, KIAA1140, Tetratricopeptide repeat protein 7A
Reference ARO-P11883
Note For research use only.
Molecular Constructor
Arg675–Thr811

Introduction

Recombinant Human TTC7A Protein, also known as Tetratricopeptide Repeat Domain 7A, is a protein that plays a crucial role in the regulation of intestinal epithelial cell integrity and barrier function. It is a highly conserved protein found in various organisms, including humans. In this article, we will discuss the structure, activity, and application of this protein in detail.

Structure of Recombinant Human TTC7A Protein

The human TTC7A gene is located on chromosome 2 and encodes a protein of 1,555 amino acids. The protein is composed of multiple domains, including a Tetratricopeptide Repeat (TPR) domain, a C-terminal coiled-coil domain, and a N-terminal domain. The TPR domain is responsible for protein-protein interactions and is composed of multiple repeats of 34 amino acids. The coiled-coil domain is involved in protein oligomerization, while the N-terminal domain is responsible for binding to other proteins and signaling molecules.

The recombinant human TTC7A protein is produced through genetic engineering techniques, where the gene is inserted into a suitable expression system, such as bacteria, yeast, or mammalian cells. This allows for the production of large quantities of the protein in a controlled and efficient manner.

Activity of Recombinant Human TTC7A Protein

The main function of TTC7A protein is to maintain the integrity and barrier function of the intestinal epithelial cells. It does so by regulating the assembly and disassembly of tight junctions, which are essential for maintaining the barrier between the intestinal lumen and the underlying tissues. The protein achieves this by interacting with other proteins, such as occludin and claudins, which are important components of tight junctions.

Studies have also shown that TTC7A protein plays a role in the regulation of cell proliferation and differentiation. It has been found to interact with the Wnt signaling pathway, which is involved in cell growth and differentiation. This suggests that the protein may have a broader role in cellular processes beyond its function in intestinal epithelial cells.

Application of Recombinant Human TTC7A Protein

The recombinant human TTC7A protein has various applications in both research and therapeutic settings. Its role in regulating tight junctions makes it a valuable tool for studying intestinal barrier function and intestinal diseases, such as inflammatory bowel disease and celiac disease. Researchers can use the protein to study the mechanisms of tight junction assembly and disassembly and to identify potential therapeutic targets for these diseases.

In terms of therapeutics, TTC7A protein has shown potential as a target for drug development. Studies have shown that mutations in the TTC7A gene can lead to a rare genetic disorder called multiple intestinal atresia, which is characterized by intestinal obstruction. By understanding the role of TTC7A protein in this disorder, researchers can develop targeted therapies to treat it.

Additionally, the recombinant human TTC7A protein has been used in preclinical studies as a potential therapeutic for inflammatory bowel disease. By targeting the protein, researchers hope to restore the integrity of the intestinal barrier and reduce inflammation in the gut.

Conclusion

In summary, Recombinant Human TTC7A Protein is a crucial protein involved in maintaining the integrity and barrier function of intestinal epithelial cells. Its structure, activity, and various applications make it a valuable tool for studying intestinal diseases and developing targeted therapies. Further research on this protein may lead to a better understanding of its role in cellular processes and the development of novel treatments for intestinal disorders.

Recombinant Human TTC7A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TTC7A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products