Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TRPV6/ECaC2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H1D0
Molecular weight:
28.27 kDa

Original price was: €234.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Ser87–Asp319
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TRPV6/ECaC2 Protein, N-His

Product name ARO-P11868-100
Uniprot ID Q9H1D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPLLLAAKDNDVQALNKLLKYEDCKVHQRGAMGETALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAFRRSPCNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDRHGDHLQPLDLVPNHQGLTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLYD
Molecular weight 28.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser87-Asp319
Aliases /Synonyms CaT1, Transient receptor potential cation channel subfamily V member 6, CaT-like, TrpV6, CaT-L, ECAC2, TRPV6, ECaC2, Epithelial calcium channel 2, Calcium transport protein 1
Reference ARO-P11868
Note For research use only.
Molecular Constructor
Ser87–Asp319
Product name ARO-P11868-1MG
Uniprot ID Q9H1D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPLLLAAKDNDVQALNKLLKYEDCKVHQRGAMGETALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAFRRSPCNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDRHGDHLQPLDLVPNHQGLTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLYD
Molecular weight 28.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser87-Asp319
Aliases /Synonyms CaT1, Transient receptor potential cation channel subfamily V member 6, CaT-like, TrpV6, CaT-L, ECAC2, TRPV6, ECaC2, Epithelial calcium channel 2, Calcium transport protein 1
Reference ARO-P11868
Note For research use only.
Molecular Constructor
Ser87–Asp319
Product name ARO-P11868-50
Uniprot ID Q9H1D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPLLLAAKDNDVQALNKLLKYEDCKVHQRGAMGETALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAFRRSPCNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDRHGDHLQPLDLVPNHQGLTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLYD
Molecular weight 28.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser87-Asp319
Aliases /Synonyms CaT1, Transient receptor potential cation channel subfamily V member 6, CaT-like, TrpV6, CaT-L, ECAC2, TRPV6, ECaC2, Epithelial calcium channel 2, Calcium transport protein 1
Reference ARO-P11868
Note For research use only.
Molecular Constructor
Ser87–Asp319

Introduction

Recombinant Human TRPV6/ECaC2 Protein, also known as transient receptor potential vanilloid 6 and epithelial calcium channel 2, is a protein that plays a crucial role in calcium homeostasis and absorption in the body. This protein is encoded by the TRPV6 gene and is expressed predominantly in the epithelial cells of the small intestine, colon, and kidney. In this article, we will discuss the structure, activity, and applications of Recombinant Human TRPV6/ECaC2 Protein.

Structure of Recombinant Human TRPV6/ECaC2 Protein

Recombinant Human TRPV6/ECaC2 Protein is a transmembrane protein with a molecular weight of approximately 100 kDa. It consists of 801 amino acids and contains six transmembrane domains, with a large intracellular loop between the fifth and sixth transmembrane domains. The N- and C-termini of the protein are located in the cytoplasm. The structure of this protein is similar to other members of the transient receptor potential (TRP) family of ion channels.

Activity of Recombinant Human TRPV6/ECaC2 Protein

Recombinant Human TRPV6/ECaC2 Protein functions as a calcium-selective ion channel, allowing for the transport of calcium ions across the cell membrane. It is activated by both intracellular and extracellular factors, including hormones, growth factors, and vitamin D. The activation of this protein leads to an increase in intracellular calcium levels, which is essential for many cellular processes such as cell signaling, muscle contraction, and bone formation.

Regulation of Recombinant Human TRPV6/ECaC2 Protein

The activity of Recombinant Human TRPV6/ECaC2 Protein is tightly regulated to maintain calcium homeostasis in the body. This protein is regulated at both the transcriptional and post-translational levels. Hormones such as parathyroid hormone (PTH) and 1,25-dihydroxyvitamin D3 (1,25(OH)2D3) can upregulate the expression of TRPV6, leading to an increase in calcium absorption. On the other hand, inflammatory cytokines can downregulate TRPV6 expression, reducing calcium absorption.

Applications of Recombinant Human TRPV6/ECaC2 Protein

Recombinant Human TRPV6/ECaC2 Protein has various applications in both research and clinical settings. Some of the key applications of this protein include:

1. Research on Calcium Homeostasis

Recombinant Human TRPV6/ECaC2 Protein is an essential tool for studying calcium homeostasis and absorption. Researchers can use this protein to investigate the role of TRPV6 in calcium transport and its regulation by various factors. It can also be used to study the effects of mutations in the TRPV6 gene on calcium absorption and related diseases.

2. Development of Therapeutics

The dysregulation of calcium homeostasis is associated with various diseases, including osteoporosis, kidney stones, and cancer. Recombinant Human TRPV6/ECaC2 Protein can be used to develop therapeutics that target this protein and modulate its activity. For example, inhibitors of TRPV6 may be useful in treating hypercalcemia, while activators of TRPV6 may help in treating calcium deficiency disorders.

3. Diagnostic Marker

Abnormal levels of TRPV6 expression have been observed in certain diseases, making it a potential diagnostic marker. For instance, increased TRPV6 expression has been linked to prostate cancer, while decreased expression has been associated with inflammatory bowel disease. Measuring TRPV6 levels in patients could aid in early diagnosis and monitoring of these diseases.

4. Vaccine Development

Recombinant Human TRPV6/ECaC

Recombinant Human TRPV6/ECaC2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TRPV6/ECaC2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products