Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human S100A12, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P80511
Molecular weight:
12.88 kDa

Original price was: €389.00.Current price is: €319.00.

100ug 18% OFF + 319 loyalty points
Met1–Glu92
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human S100A12, N-His

Product name ARO-P12873-100
Uniprot ID P80511
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Molecular weight 12.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu92
Aliases /Synonyms Migration inhibitory factor-related protein 6, MRP-6, Extracellular newly identified RAGE-binding protein, p6, Calcium-binding protein in amniotic fluid 1, Calgranulin-C, Protein S100-A12, CGRP, S100 calcium-binding protein A12, Neutrophil S100 protein, CAAF1, EN-RAGE, S100A12, CAGC
Reference ARO-P12873
Note For research use only.
Molecular Constructor
Met1–Glu92
Product name ARO-P12873-1MG
Uniprot ID P80511
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Molecular weight 12.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu92
Aliases /Synonyms Migration inhibitory factor-related protein 6, MRP-6, Extracellular newly identified RAGE-binding protein, p6, Calcium-binding protein in amniotic fluid 1, Calgranulin-C, Protein S100-A12, CGRP, S100 calcium-binding protein A12, Neutrophil S100 protein, CAAF1, EN-RAGE, S100A12, CAGC
Reference ARO-P12873
Note For research use only.
Molecular Constructor
Met1–Glu92
Product name ARO-P12873-50
Uniprot ID P80511
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Molecular weight 12.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu92
Aliases /Synonyms Migration inhibitory factor-related protein 6, MRP-6, Extracellular newly identified RAGE-binding protein, p6, Calcium-binding protein in amniotic fluid 1, Calgranulin-C, Protein S100-A12, CGRP, S100 calcium-binding protein A12, Neutrophil S100 protein, CAAF1, EN-RAGE, S100A12, CAGC
Reference ARO-P12873
Note For research use only.
Molecular Constructor
Met1–Glu92

Introduction to Recombinant Human S100A12

Recombinant Human S100A12 is a protein that belongs to the S100 family of calcium-binding proteins. It is also known as Calgranulin C, EN-RAGE, and Calcium-binding protein in amniotic fluid 1 (CABP1). This protein is encoded by the S100A12 gene and is expressed in various tissues, including the immune system, skin, and gastrointestinal tract. Recombinant Human S100A12 is a highly conserved protein and has been found to play a crucial role in various physiological and pathological processes.

Structure of Recombinant Human S100A12

Recombinant Human S100A12 is a small protein with a molecular weight of approximately 10 kDa. It is composed of 92 amino acids and has a globular structure with two calcium-binding EF-hand motifs. These motifs are responsible for the calcium-dependent conformational changes of the protein, which are essential for its biological activity. The protein also contains a C-terminal extension that is involved in its interaction with other proteins.

Activity of Recombinant Human S100A12

Recombinant Human S100A12 has been found to have diverse activities in different biological processes. It is primarily known for its role in the regulation of inflammation and immune response. The protein acts as a damage-associated molecular pattern (DAMP) molecule and activates the receptor for advanced glycation end products (RAGE) on immune cells, leading to the production of pro-inflammatory cytokines and chemokines. This activity of Recombinant Human S100A12 has been implicated in various inflammatory diseases, such as rheumatoid arthritis, inflammatory bowel disease, and atherosclerosis.

Apart from its role in inflammation, Recombinant Human S100A12 has also been found to have antimicrobial activity. It can inhibit the growth of various bacteria, including Staphylococcus aureus and Pseudomonas aeruginosa, by disrupting their cell membranes. This antimicrobial activity of the protein is attributed to its ability to bind to lipopolysaccharides (LPS) present on the surface of bacterial cells.

Furthermore, Recombinant Human S100A12 has been shown to have a role in wound healing. It promotes the migration of keratinocytes and fibroblasts, which are essential for the repair of damaged tissues. The protein also stimulates the production of extracellular matrix proteins, such as collagen and fibronectin, which are crucial for tissue regeneration.

Application of Recombinant Human S100A12

Due to its diverse activities, Recombinant Human S100A12 has been studied for its potential therapeutic applications. One of the major applications of this protein is in the treatment of inflammatory diseases. Several studies have shown that blocking the interaction of Recombinant Human S100A12 with RAGE can reduce inflammation and improve disease outcomes in animal models of inflammatory diseases. This has led to the development of RAGE inhibitors as potential therapeutic agents for these conditions.

Recombinant Human S100A12 has also been investigated for its potential as an antimicrobial agent. Its ability to inhibit the growth of bacteria makes it a promising candidate for the development of new antibiotics. Additionally, the protein has been shown to have a role in the formation of biofilms, which are involved in chronic infections. Therefore, targeting Recombinant Human S100A12 may provide a novel approach for the treatment of biofilm-associated infections.

Moreover, Recombinant Human S100A12 has been studied for its potential as a biomarker for various diseases. Elevated levels of the protein have been found in the blood and tissues of patients with inflammatory diseases, making it a potential diagnostic marker for these conditions. It has also been proposed as a prognostic marker for certain types of cancer, such as breast and colorectal cancer.

Conclusion

In summary, Recombinant Human S100A12 is a small calcium-binding protein with diverse activities in inflammation, wound healing, and antimicrobial

Recombinant Human S100A12, N-His

There are no reviews yet.

Be the first to review “Recombinant Human S100A12, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products