Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human QKI Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96PU8
Molecular weight:
23.86 kDa

Original price was: €237.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Thr14–Gly202
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human QKI Protein, N-His

Product name ARO-P12272-100
Uniprot ID Q96PU8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNG
Molecular weight 23.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr14-Gly202
Aliases /Synonyms QKI, HqkI, HKQ, Hqk, Protein quaking
Reference ARO-P12272
Note For research use only.
Molecular Constructor
Thr14–Gly202
Product name ARO-P12272-1MG
Uniprot ID Q96PU8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNG
Molecular weight 23.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr14-Gly202
Aliases /Synonyms QKI, HqkI, HKQ, Hqk, Protein quaking
Reference ARO-P12272
Note For research use only.
Molecular Constructor
Thr14–Gly202
Product name ARO-P12272-50
Uniprot ID Q96PU8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNG
Molecular weight 23.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr14-Gly202
Aliases /Synonyms QKI, HqkI, HKQ, Hqk, Protein quaking
Reference ARO-P12272
Note For research use only.
Molecular Constructor
Thr14–Gly202

Introduction to Recombinant Human QKI Protein

Recombinant Human QKI Protein, also known as Quaking Protein, is a highly conserved RNA-binding protein that plays a crucial role in regulating gene expression and post-transcriptional processing of RNA. It is a member of the STAR (Signal Transduction and Activation of RNA) family of proteins and is encoded by the QKI gene located on chromosome 6 in humans.

Structure of Recombinant Human QKI Protein

The Recombinant Human QKI Protein is a 315 amino acid protein with a molecular weight of approximately 34 kDa. It consists of three major domains: an N-terminal STAR domain, a central KH domain, and a C-terminal QUA2 domain. The STAR domain is responsible for RNA binding and contains two RNA recognition motifs (RRMs). The KH domain is involved in protein-protein interactions and the QUA2 domain is responsible for nuclear localization and homodimerization of the protein.

The crystal structure of Recombinant Human QKI Protein has been determined and it is found to form a homodimer in its active form. The dimerization of QKI is essential for its RNA binding and regulatory functions. The protein is also post-translationally modified by phosphorylation and acetylation, which can modulate its activity and stability.

Activity of Recombinant Human QKI Protein

Recombinant Human QKI Protein is a multifunctional protein that has been shown to play a critical role in a variety of cellular processes, including RNA splicing, stability, and localization. It is involved in the regulation of alternative splicing, which is a process that generates multiple mRNA isoforms from a single gene. QKI binds to specific RNA sequences and controls the splicing of target genes, thereby regulating their expression levels and functions.

In addition to its role in splicing, Recombinant Human QKI Protein also regulates the stability and localization of target mRNAs. It binds to the 3’ untranslated region (UTR) of target mRNAs and promotes their stability and transport to specific subcellular compartments. This is crucial for the proper functioning of cells, as misregulation of mRNA stability and localization can lead to various diseases, including cancer.

Moreover, Recombinant Human QKI Protein has been shown to interact with other proteins involved in RNA processing and translation, such as the RNA helicase DHX9 and the translation initiation factor eIF4E. These interactions further highlight the role of QKI in regulating gene expression at multiple levels.

Application of Recombinant Human QKI Protein

The unique RNA-binding and regulatory functions of Recombinant Human QKI Protein make it a valuable tool for various research applications. It has been extensively studied in the context of neurodevelopment and neurodegenerative diseases, as QKI is highly expressed in the brain and has been implicated in the regulation of neuronal differentiation and myelination.

Furthermore, Recombinant Human QKI Protein has been shown to be involved in the development and progression of various cancers, including breast, lung, and prostate cancer. Its role in regulating alternative splicing and mRNA stability of oncogenes and tumor suppressor genes makes it a potential target for cancer therapy.

In addition, Recombinant Human QKI Protein has been shown to play a crucial role in the pathogenesis of multiple sclerosis (MS), a chronic inflammatory disease of the central nervous system. QKI has been found to regulate the differentiation and function of oligodendrocytes, the cells responsible for myelination of neurons. Dysregulation of QKI has been linked to the development of MS, making it a potential therapeutic target for this disease.

Conclusion

In summary, Recombinant Human QKI Protein is a multifunctional protein with crucial roles in regulating gene expression and post-transcriptional processing of RNA. Its unique structure and

Recombinant Human QKI Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human QKI Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products